Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4301
Gene name
LocationContig_220:1920..3637
Strand-
Gene length (bp)1717
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07766 LETM1 LETM1-like protein 7.1E-103 148 412

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13920|MDM28_SCHPO LETM1 domain-containing protein mdm28, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm28 PE=2 SV=3 144 467 3.0E-123
sp|Q06493|YLH47_YEAST LETM1 domain-containing protein YLH47, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLH47 PE=1 SV=1 141 467 8.0E-99
sp|Q08179|MDM38_YEAST Mitochondrial distribution and morphology protein 38 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM38 PE=1 SV=1 145 532 1.0E-85
sp|Q5ZK33|LETM1_CHICK LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Gallus gallus GN=LETM1 PE=2 SV=1 145 489 4.0E-84
sp|Q0VCA3|LETM1_BOVIN LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Bos taurus GN=LETM1 PE=2 SV=1 148 510 5.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13920|MDM28_SCHPO LETM1 domain-containing protein mdm28, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdm28 PE=2 SV=3 144 467 3.0E-123
sp|Q06493|YLH47_YEAST LETM1 domain-containing protein YLH47, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLH47 PE=1 SV=1 141 467 8.0E-99
sp|Q08179|MDM38_YEAST Mitochondrial distribution and morphology protein 38 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM38 PE=1 SV=1 145 532 1.0E-85
sp|Q5ZK33|LETM1_CHICK LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Gallus gallus GN=LETM1 PE=2 SV=1 145 489 4.0E-84
sp|Q0VCA3|LETM1_BOVIN LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Bos taurus GN=LETM1 PE=2 SV=1 148 510 5.0E-83
sp|Q1LY46|LETM1_DANRE LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Danio rerio GN=letm1 PE=3 SV=2 139 481 6.0E-79
sp|Q0VA06|LETM1_XENTR LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Xenopus tropicalis GN=letm1 PE=2 SV=1 142 528 5.0E-78
sp|Q9Z2I0|LETM1_MOUSE LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Mus musculus GN=Letm1 PE=1 SV=1 147 477 3.0E-72
sp|O95202|LETM1_HUMAN LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Homo sapiens GN=LETM1 PE=1 SV=1 145 481 4.0E-72
sp|Q5XIN6|LETM1_RAT LETM1 and EF-hand domain-containing protein 1, mitochondrial OS=Rattus norvegicus GN=Letm1 PE=1 SV=1 145 477 5.0E-71
sp|P91927|A60DA_DROME LETM1 and EF-hand domain-containing protein anon-60Da, mitochondrial OS=Drosophila melanogaster GN=Letm1 PE=2 SV=2 148 421 2.0E-70
sp|Q7TNU7|LETM2_MOUSE LETM1 domain-containing protein LETM2, mitochondrial OS=Mus musculus GN=Letm2 PE=1 SV=1 127 415 8.0E-57
sp|Q28DA8|LETM2_XENTR LETM1 domain-containing protein LETM2, mitochondrial OS=Xenopus tropicalis GN=letm2 PE=2 SV=1 147 405 7.0E-56
sp|Q5PQQ5|LETM2_RAT LETM1 domain-containing protein LETM2, mitochondrial OS=Rattus norvegicus GN=Letm2 PE=2 SV=1 145 415 1.0E-54
sp|Q2VYF4|LETM2_HUMAN LETM1 domain-containing protein LETM2, mitochondrial OS=Homo sapiens GN=LETM2 PE=2 SV=2 150 415 3.0E-54
sp|A3KN46|LTMD1_BOVIN LETM1 domain-containing protein 1 OS=Bos taurus GN=LETMD1 PE=2 SV=1 184 398 3.0E-11
sp|Q6P1Q0|LTMD1_HUMAN LETM1 domain-containing protein 1 OS=Homo sapiens GN=LETMD1 PE=1 SV=1 184 416 1.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 201 223 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4301
MSASSAVARRAAARNPLLRGNARNLSRGISPALMTRHIARNAQVPALALLIPTRQMSTEHHRPDAQNSGPPPGFN
VEQARKPLPKEESKRDSADAGSKAAQTNPQQQQSSSDMAKADAAMTELAANKGGAAEKHELAKADKEDKKLTLWQ
KVKKEARHYWDGSKLLAAEVRISWRLALKMAAGYDLTRREHRQLQRTVKDLGRLVPFSVFIIVPLGEALLPLALK
LFPNMLPSTFEGQKSKDAKASLLRSTRNEVSAFLQHTLKETGLPLSPATAQKEEFTNFFRKVRSTGEAPTSDDVI
KVCKVFRDDMTLDNLSRPQLVSMCRYMNLNTFGTDMMLRYQIRHRMRQIKRDDKAISFEGVDSLTVAELQTACAA
RGIRTHSVSPAHMRTDLQTWLDLRLREGVPSTLLVLSNAYMYAQGSGEGTSQIDALIGVLSSIPEELFHEIELEV
HNAEGAATNKQRLEVLKEQQDLIEEENEQNEESQSTGMATPRDVEDIDEKEERQMTAEAAGIEKSPAGEMVDAES
DTARAEEQERKLRAAAEPAAKSKQD*
Coding >Hirsu2|4301
ATGAGTGCTTCGTCTGCGGTCGCCCGCAGGGCGGCAGCTCGCAATCCCCTCCTGAGGGGCAATGCCAGGAACCTG
TCCCGCGGCATCTCGCCAGCCCTCATGACGCGACACATCGCCAGGAATGCTCAGGTCCCCGCGCTGGCACTCCTG
ATCCCCACCCGACAGATGAGCACCGAGCACCATCGCCCAGACGCGCAAAACTCAGGGCCTCCTCCCGGCTTCAAC
GTCGAACAGGCCAGGAAGCCTCTGCCCAAGGAGGAAAGCAAGCGAGACAGCGCTGATGCCGGTAGCAAGGCGGCG
CAGACGAATCCGCAGCAGCAGCAGTCGTCGTCAGACATGGCCAAGGCTGATGCCGCCATGACCGAGCTGGCCGCC
AACAAGGGCGGCGCCGCCGAGAAACACGAGCTGGCCAAGGCCGATAAGGAGGACAAGAAGCTGACGCTGTGGCAA
AAAGTCAAGAAGGAGGCGCGGCACTATTGGGACGGCAGCAAGCTGCTCGCCGCCGAGGTCCGCATCAGCTGGAGA
CTGGCGCTCAAGATGGCCGCCGGCTACGATCTGACGCGCAGGGAACACAGGCAGCTGCAGCGAACAGTCAAGGAT
CTCGGCCGCCTCGTCCCCTTCTCCGTCTTCATCATCGTGCCCCTGGGCGAGGCGCTGCTGCCCCTGGCCCTCAAG
CTCTTCCCCAACATGCTGCCCAGCACCTTCGAGGGCCAAAAGTCCAAGGACGCCAAGGCGAGCCTGCTGCGCTCC
ACCCGCAACGAAGTGAGCGCATTCCTGCAGCACACGCTCAAGGAGACGGGCCTTCCCCTGAGCCCGGCCACGGCG
CAGAAGGAGGAGTTCACAAACTTCTTCCGCAAGGTGCGCTCCACCGGCGAGGCCCCCACCAGCGACGACGTTATC
AAGGTCTGCAAGGTCTTCCGCGACGACATGACGCTCGACAACCTGTCGCGGCCCCAGCTGGTGTCCATGTGTCGG
TACATGAATCTCAACACCTTTGGCACCGACATGATGCTGCGCTACCAAATCCGCCACCGCATGAGGCAGATCAAG
CGCGACGACAAGGCAATCAGCTTCGAGGGCGTCGATAGCCTCACCGTCGCGGAGCTGCAGACAGCCTGTGCCGCA
CGCGGCATCCGTACCCACAGCGTCTCGCCCGCTCATATGCGCACCGATCTGCAGACCTGGCTCGACCTGCGCCTC
CGGGAGGGCGTCCCCTCCACCCTGCTCGTCCTCAGCAACGCCTACATGTACGCCCAGGGATCCGGGGAGGGCACG
AGCCAGATTGACGCTCTCATCGGAGTGCTGTCGTCCATTCCCGAGGAGCTCTTCCACGAAATCGAGCTCGAGGTC
CACAACGCCGAGGGCGCCGCCACCAACAAGCAGCGCCTCGAGGTGCTCAAGGAGCAGCAGGACTTGATCGAGGAG
GAGAACGAGCAGAACGAGGAAAGCCAGAGCACGGGCATGGCCACTCCGCGAGACGTCGAGGACATTGACGAGAAG
GAGGAACGTCAGATGACGGCCGAGGCTGCAGGCATCGAGAAGTCGCCTGCCGGCGAAATGGTCGACGCCGAGAGC
GACACGGCCCGGGCCGAGGAGCAGGAGCGCAAGTTGCGAGCCGCTGCTGAGCCGGCCGCCAAGTCCAAGCAGGAC
TAG
Transcript >Hirsu2|4301
ATGAGTGCTTCGTCTGCGGTCGCCCGCAGGGCGGCAGCTCGCAATCCCCTCCTGAGGGGCAATGCCAGGAACCTG
TCCCGCGGCATCTCGCCAGCCCTCATGACGCGACACATCGCCAGGAATGCTCAGGTCCCCGCGCTGGCACTCCTG
ATCCCCACCCGACAGATGAGCACCGAGCACCATCGCCCAGACGCGCAAAACTCAGGGCCTCCTCCCGGCTTCAAC
GTCGAACAGGCCAGGAAGCCTCTGCCCAAGGAGGAAAGCAAGCGAGACAGCGCTGATGCCGGTAGCAAGGCGGCG
CAGACGAATCCGCAGCAGCAGCAGTCGTCGTCAGACATGGCCAAGGCTGATGCCGCCATGACCGAGCTGGCCGCC
AACAAGGGCGGCGCCGCCGAGAAACACGAGCTGGCCAAGGCCGATAAGGAGGACAAGAAGCTGACGCTGTGGCAA
AAAGTCAAGAAGGAGGCGCGGCACTATTGGGACGGCAGCAAGCTGCTCGCCGCCGAGGTCCGCATCAGCTGGAGA
CTGGCGCTCAAGATGGCCGCCGGCTACGATCTGACGCGCAGGGAACACAGGCAGCTGCAGCGAACAGTCAAGGAT
CTCGGCCGCCTCGTCCCCTTCTCCGTCTTCATCATCGTGCCCCTGGGCGAGGCGCTGCTGCCCCTGGCCCTCAAG
CTCTTCCCCAACATGCTGCCCAGCACCTTCGAGGGCCAAAAGTCCAAGGACGCCAAGGCGAGCCTGCTGCGCTCC
ACCCGCAACGAAGTGAGCGCATTCCTGCAGCACACGCTCAAGGAGACGGGCCTTCCCCTGAGCCCGGCCACGGCG
CAGAAGGAGGAGTTCACAAACTTCTTCCGCAAGGTGCGCTCCACCGGCGAGGCCCCCACCAGCGACGACGTTATC
AAGGTCTGCAAGGTCTTCCGCGACGACATGACGCTCGACAACCTGTCGCGGCCCCAGCTGGTGTCCATGTGTCGG
TACATGAATCTCAACACCTTTGGCACCGACATGATGCTGCGCTACCAAATCCGCCACCGCATGAGGCAGATCAAG
CGCGACGACAAGGCAATCAGCTTCGAGGGCGTCGATAGCCTCACCGTCGCGGAGCTGCAGACAGCCTGTGCCGCA
CGCGGCATCCGTACCCACAGCGTCTCGCCCGCTCATATGCGCACCGATCTGCAGACCTGGCTCGACCTGCGCCTC
CGGGAGGGCGTCCCCTCCACCCTGCTCGTCCTCAGCAACGCCTACATGTACGCCCAGGGATCCGGGGAGGGCACG
AGCCAGATTGACGCTCTCATCGGAGTGCTGTCGTCCATTCCCGAGGAGCTCTTCCACGAAATCGAGCTCGAGGTC
CACAACGCCGAGGGCGCCGCCACCAACAAGCAGCGCCTCGAGGTGCTCAAGGAGCAGCAGGACTTGATCGAGGAG
GAGAACGAGCAGAACGAGGAAAGCCAGAGCACGGGCATGGCCACTCCGCGAGACGTCGAGGACATTGACGAGAAG
GAGGAACGTCAGATGACGGCCGAGGCTGCAGGCATCGAGAAGTCGCCTGCCGGCGAAATGGTCGACGCCGAGAGC
GACACGGCCCGGGCCGAGGAGCAGGAGCGCAAGTTGCGAGCCGCTGCTGAGCCGGCCGCCAAGTCCAAGCAGGAC
TAG
Gene >Hirsu2|4301
ATGAGTGCTTCGTCTGCGGTCGCCCGCAGGGCGGCAGCTCGCAATCCCCTCCTGAGGGGCAATGGTGCGCCTCCT
CATTCGCGGCCTGCCGTCGCCCATTCGGAGACGCCGCTAATTCGAGAGTACAGCCAGGAACCTGTCCCGCGGCAT
CTCGCCAGCCCTCATGACGCGACACATCGCCAGGAATGCTCAGGTCCCCGCGCTGGCACTCCTGATCCCCACCCG
ACAGATGAGCACCGAGCACCATCGCCCAGACGCGCAAAACTCAGGGCCTCCTCCCGGCTTCAACGTCGAACAGGC
CAGGAAGCCTCTGCCCAAGGAGGAAAGCAAGCGAGACAGCGCTGATGCCGGTAGCAAGGCGGCGCAGACGAATCC
GCAGCAGCAGCAGTCGTCGTCAGACATGGCCAAGGCTGATGCCGCCATGACCGAGCTGGCCGCCAACAAGGGCGG
CGCCGCCGAGAAACACGAGCTGGCCAAGGCCGATAAGGAGGACAAGAAGCTGACGCTGTGGCAAAAAGTCAAGAA
GGAGGCGCGGCACTATTGGGACGGCAGCAAGCTGCTCGCCGCCGAGGTCCGCATCAGCTGGAGACTGGCGCTCAA
GATGGCCGCCGGCTACGATCTGACGCGCAGGGAACACAGGCAGCTGCAGCGAACAGTCAAGGATCTCGGCCGCCT
CGTCCCCTTCTCCGTCTTCATCATCGTGCCCCTGGGCGAGGCGCTGCTGCCCCTGGCCCTCAAGCTCTTCCCCAA
CATGCTGCCCAGCACCTTCGAGGGCCAAAAGTCCAAGGACGCCAAGGCGAGCCTGCTGCGCTCCACCCGCAACGA
AGTGAGCGCATTCCTGCAGCACACGCTCAAGGAGACGGGCCTTCCCCTGAGCCCGGCCACGGCGCAGAAGGAGGA
GTTCACAAACTTCTTCCGCAAGGTGCGCTCCACCGGCGAGGCCCCCACCAGCGACGACGTTATCAAGGTCTGCAA
GGTCTTCCGCGACGACATGACGCTCGACAACCTGTCGCGGCCCCAGCTGGTGTCCATGTGTCGGTACATGAATCT
CAACACCTTTGGCACCGACATGATGCTGCGCTACCAAATCCGCCACCGCATGAGGCAGATCAAGCGCGACGACAA
GGCAATCAGCTTCGAGGGCGTCGATAGCCTCACCGTCGCGGAGCTGCAGACAGCCTGTGCCGCACGCGGCATCCG
TACCCACAGCGTCTCGCCCGCTCATATGCGCACCGATCTGCAGACCTGGCTCGACCTGCGCCTCCGGGAGGGCGT
CCCCTCCACCCTGCTCGTCCTCAGCAACGCCTACATGTACGCCCAGGGATCCGGGGAGGGCACGAGCCAGATTGA
CGCTCTCATCGGAGTGCTGTCGTCCATTCCCGAGGAGCTCTTCCACGAAATCGAGCTCGAGGTCCACAACGCCGA
GGGCGCCGCCACCAACAAGCAGCGCCTCGAGGTGCTCAAGGAGCAGCAGGACTTGATCGAGGAGGAGAACGAGCA
GAACGAGGAAAGCCAGAGCACGGGCATGGCCACTCCGCGAGACGTCGAGGACATTGACGAGAAGGAGGAACGTCA
GATGACGGCCGAGGCTGCAGGCATCGAGAAGTCGCCTGCCGGCGAAATGGTCGACGCCGAGAGCGACACGGCCCG
GGCCGAGGAGCAGGAGCGCAAGTTGCGAGCCGCTGCTGAGCCGGCCGCCAAGTCCAAGCAGGACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail