Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|430
Gene name
LocationContig_1087:3792..4931
Strand-
Gene length (bp)1139
Transcript length (bp)498
Coding sequence length (bp)498
Protein length (aa) 166

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 2.0E-14 59 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87304|YB22_SCHPO Putative esterase C31F10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC31F10.02 PE=3 SV=1 9 150 6.0E-30
sp|Q5R833|ACO13_PONAB Acyl-coenzyme A thioesterase 13 OS=Pongo abelii GN=ACOT13 PE=2 SV=1 28 146 2.0E-21
sp|Q9NPJ3|ACO13_HUMAN Acyl-coenzyme A thioesterase 13 OS=Homo sapiens GN=ACOT13 PE=1 SV=1 28 146 2.0E-21
sp|Q9CQR4|ACO13_MOUSE Acyl-coenzyme A thioesterase 13 OS=Mus musculus GN=Acot13 PE=1 SV=1 13 146 4.0E-20
sp|P34419|YLZ6_CAEEL Putative esterase F42H10.6 OS=Caenorhabditis elegans GN=F42H10.6 PE=1 SV=2 47 141 7.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87304|YB22_SCHPO Putative esterase C31F10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC31F10.02 PE=3 SV=1 9 150 6.0E-30
sp|Q5R833|ACO13_PONAB Acyl-coenzyme A thioesterase 13 OS=Pongo abelii GN=ACOT13 PE=2 SV=1 28 146 2.0E-21
sp|Q9NPJ3|ACO13_HUMAN Acyl-coenzyme A thioesterase 13 OS=Homo sapiens GN=ACOT13 PE=1 SV=1 28 146 2.0E-21
sp|Q9CQR4|ACO13_MOUSE Acyl-coenzyme A thioesterase 13 OS=Mus musculus GN=Acot13 PE=1 SV=1 13 146 4.0E-20
sp|P34419|YLZ6_CAEEL Putative esterase F42H10.6 OS=Caenorhabditis elegans GN=F42H10.6 PE=1 SV=2 47 141 7.0E-10
sp|P95914|Y2140_SULSO Putative esterase SSO2140 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2140 PE=3 SV=1 35 147 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|430
MAAKKLSPMPFTKAVMRSFMAESGLEPRLFGPRFRVTGASSGRVDFELDIHKDHTNRLQTIHGGTLASLVDLGGS
LAVASTGRFATGVSTDLNITYLAPGGKPGDLLKGTAVCDKIGKTLAYTTVTFTNNKGQLAARGSHTKYVANTMGE
QGPYAAPPEFAEDID*
Coding >Hirsu2|430
ATGGCGGCGAAGAAACTGAGTCCCATGCCTTTCACAAAGGCCGTGATGCGCTCCTTCATGGCCGAGTCCGGCCTG
GAACCGAGATTGTTCGGCCCGCGGTTCCGGGTGACGGGCGCGTCGAGCGGCCGCGTCGACTTCGAGCTCGACATC
CACAAGGACCACACCAACAGGCTTCAGACGATCCATGGCGGCACCCTCGCCAGCCTCGTTGACCTCGGCGGCTCG
CTGGCCGTGGCGTCGACCGGCCGCTTCGCCACGGGCGTGTCGACGGATCTCAACATCACCTATCTCGCTCCCGGA
GGCAAGCCCGGCGATCTGCTCAAGGGCACCGCCGTCTGCGACAAGATCGGCAAGACGCTGGCCTACACGACCGTC
ACCTTCACCAACAACAAGGGACAGCTCGCGGCCAGGGGCAGCCACACCAAATACGTTGCCAACACCATGGGCGAA
CAGGGGCCCTACGCGGCCCCTCCGGAGTTTGCAGAGGACATTGACTAG
Transcript >Hirsu2|430
ATGGCGGCGAAGAAACTGAGTCCCATGCCTTTCACAAAGGCCGTGATGCGCTCCTTCATGGCCGAGTCCGGCCTG
GAACCGAGATTGTTCGGCCCGCGGTTCCGGGTGACGGGCGCGTCGAGCGGCCGCGTCGACTTCGAGCTCGACATC
CACAAGGACCACACCAACAGGCTTCAGACGATCCATGGCGGCACCCTCGCCAGCCTCGTTGACCTCGGCGGCTCG
CTGGCCGTGGCGTCGACCGGCCGCTTCGCCACGGGCGTGTCGACGGATCTCAACATCACCTATCTCGCTCCCGGA
GGCAAGCCCGGCGATCTGCTCAAGGGCACCGCCGTCTGCGACAAGATCGGCAAGACGCTGGCCTACACGACCGTC
ACCTTCACCAACAACAAGGGACAGCTCGCGGCCAGGGGCAGCCACACCAAATACGTTGCCAACACCATGGGCGAA
CAGGGGCCCTACGCGGCCCCTCCGGAGTTTGCAGAGGACATTGACTAG
Gene >Hirsu2|430
ATGGCGGCGAAGAAACTGAGTCCCATGCCTTTCACAAAGGCCGTACGTGCCCCTCTAGAGAAGCAAGGGCGGCAG
CGGGGAGGGAGGCGTTGACCGGGCCCCCTAGGTGATGCGCTCCTTCATGGCCGAGTCCGGCCTGGAACCGAGGTA
CGAAGCTGCCGTTCGCCGCCCCATGGGACCGCACGAGAGATGCAGGCAGATGAGAGGCCGACGAGAGAGGGGAAA
AAGGAGGACGCTTGGTTTGGCGTCGGAGAGAAAAAGGGGGGTGGGTGGGATGAAGGAGAAGAGTCGGGAGTGCTG
ATGAGGAAGATTGTCCAGATTGTTCGGCCCGCGGGTATGCCGAGCCCTCCCGCCGTAGCCAGGCTCGAGAGCTGA
CGTCGTGCGCGCCCGCCTCTCGTCCAGTTCCGGGTGACGGGCGCGTCGAGCGGCCGCGTCGACTTCGAGCTCGAC
ATCCACAAGGACCACACCGTACGCGCGCCTTTCTTTCATCTCTGCCGCAAAAAGAGGCACTGACGCGAGCGCGGT
AGAACAGGCTTCAGACGATCCATGGCGGCACCCTCGCCAGCCTCGTTGACCTCGGCGGCTCGCTGGCCGTGGCGT
CGACCGGCCGCTTCGCCACGGGCGTGTCGACGGATCTCAACAGTACCTCGCCTCCCCTTCCATCTACTCTCCCCT
CCCCGGCCGCCATTCCCCTGATCGTGGGACGACGACGTCTTGCGCGCGTGTGCTTGCCGAGGCCGCTGCTGACCG
CCGTCGGCCACCAGTCACCTATCTCGCTCCCGGAGGCAAGCCCGGCGATCTGCTCAAGGGCACCGCCGTCTGCGA
CAAGAGTACGTTGCCCACGCCTGTCTCTCTCCCCCTCTGCGCTCTGTCGCAAGATGCGCGGAAAGGTTCGGTCTA
GGTGGAGGGATGCTACTGACGCAGTCAGCAGTCGGCAAGACGCTGGCCTACACGACCGTCACCTTCACCAACAAC
AAGGGACAGCTCGCGGCCAGGGGCAGCCACACCAAGTACGTCGTCCTGCGTGACGCTGCCGACGACGACGGCGAG
GCTGACGACAAGCCAGATACGTTGCCAACACCATGGGCGAACAGGGGCCCTACGCGGCCCCTCCGGAGTTTGCAG
AGGACATTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail