Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|43
Gene name
LocationContig_1001:2942..3290
Strand-
Gene length (bp)348
Transcript length (bp)348
Coding sequence length (bp)348
Protein length (aa) 116

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular Signal peptide 0.6337 0.4879 0.7406 0.143 0.2445 0.0676 0.0956 0.1998 0.1542 0.0461

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup9578
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|43 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|43
MEPLGGGPGRPARGHRPPSKPPVSQTSARRPRNGHGREDALFSNGRVRGHPAHVAVLRTGWPVRVSREAMPQLPV
RAPASSSHPFDAIALSLARRSRSRSRWKPVLCPEQFRIGP*
Coding >Hirsu2|43
ATGGAACCCCTGGGTGGAGGCCCAGGCCGGCCGGCTCGAGGGCATCGCCCTCCGTCGAAGCCTCCTGTCTCTCAA
ACCTCTGCCCGGCGGCCTCGAAACGGCCACGGTCGGGAGGATGCGCTCTTCTCGAACGGTCGGGTCCGGGGCCAC
CCGGCCCACGTGGCCGTCTTGCGCACGGGCTGGCCGGTCCGAGTCTCGCGCGAGGCCATGCCGCAACTGCCGGTC
CGTGCGCCGGCCTCCTCTTCTCATCCTTTCGACGCAATCGCCCTCTCCTTGGCCCGCCGGAGCCGATCGCGGTCC
CGATGGAAGCCCGTCCTCTGCCCCGAGCAATTTCGCATAGGTCCCTAG
Transcript >Hirsu2|43
ATGGAACCCCTGGGTGGAGGCCCAGGCCGGCCGGCTCGAGGGCATCGCCCTCCGTCGAAGCCTCCTGTCTCTCAA
ACCTCTGCCCGGCGGCCTCGAAACGGCCACGGTCGGGAGGATGCGCTCTTCTCGAACGGTCGGGTCCGGGGCCAC
CCGGCCCACGTGGCCGTCTTGCGCACGGGCTGGCCGGTCCGAGTCTCGCGCGAGGCCATGCCGCAACTGCCGGTC
CGTGCGCCGGCCTCCTCTTCTCATCCTTTCGACGCAATCGCCCTCTCCTTGGCCCGCCGGAGCCGATCGCGGTCC
CGATGGAAGCCCGTCCTCTGCCCCGAGCAATTTCGCATAGGTCCCTAG
Gene >Hirsu2|43
ATGGAACCCCTGGGTGGAGGCCCAGGCCGGCCGGCTCGAGGGCATCGCCCTCCGTCGAAGCCTCCTGTCTCTCAA
ACCTCTGCCCGGCGGCCTCGAAACGGCCACGGTCGGGAGGATGCGCTCTTCTCGAACGGTCGGGTCCGGGGCCAC
CCGGCCCACGTGGCCGTCTTGCGCACGGGCTGGCCGGTCCGAGTCTCGCGCGAGGCCATGCCGCAACTGCCGGTC
CGTGCGCCGGCCTCCTCTTCTCATCCTTTCGACGCAATCGCCCTCTCCTTGGCCCGCCGGAGCCGATCGCGGTCC
CGATGGAAGCCCGTCCTCTGCCCCGAGCAATTTCGCATAGGTCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail