Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4295
Gene name
LocationContig_22:33139..35377
Strand+
Gene length (bp)2238
Transcript length (bp)2238
Coding sequence length (bp)2238
Protein length (aa) 746

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 1.6E-20 304 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 163 624 6.0E-37
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 238 624 3.0E-36
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 154 624 2.0E-34
sp|P32791|FRE1_YEAST Ferric/cupric reductase transmembrane component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE1 PE=1 SV=1 298 745 4.0E-32
sp|P78588|FREL_CANAX Probable ferric reductase transmembrane component OS=Candida albicans GN=CFL1 PE=3 SV=1 252 625 4.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 163 624 6.0E-37
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 238 624 3.0E-36
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 154 624 2.0E-34
sp|P32791|FRE1_YEAST Ferric/cupric reductase transmembrane component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE1 PE=1 SV=1 298 745 4.0E-32
sp|P78588|FREL_CANAX Probable ferric reductase transmembrane component OS=Candida albicans GN=CFL1 PE=3 SV=1 252 625 4.0E-29
sp|Q5A446|FRE1_CANAL Ferric/cupric reductase transmembrane component 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFL1 PE=2 SV=1 252 625 7.0E-29
sp|Q08908|FRE5_YEAST Ferric reductase transmembrane component 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE5 PE=2 SV=1 202 655 4.0E-26
sp|Q12473|FRE6_YEAST Ferric reductase transmembrane component 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE6 PE=1 SV=1 134 510 4.0E-24
sp|Q04800|FRP1_SCHPO Ferric reductase transmembrane component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp1 PE=1 SV=1 296 680 1.0E-11
sp|Q12333|FRE7_YEAST Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE7 PE=1 SV=2 299 637 1.0E-10
sp|O94727|FRP2_SCHPO Ferric/cupric reductase transmembrane component 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp2 PE=3 SV=1 299 515 1.0E-09
sp|A6ZN61|FRE7_YEAS7 Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain YJM789) GN=FRE7 PE=3 SV=1 299 637 3.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 200 222 22
3 260 282 22
4 341 363 22
5 378 400 22
6 407 429 22
7 434 456 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4295
MGLRQLSLLSLLPYKVLSGATSYGEDSGLIGYGIQLFQPVCAFACLFSIAPPLNCSREDMTAPAPKDKYTVRVKN
GQLPSGEGWHVTPDATPQCKQHDDFYLQTVAFCIQAHCEDVPLMRLEKFWDSNVPWQMFNDKKYQPVPRQTYSQA
LGAIRDPPRRPVNNTVLLNYTAMVPEETYLRQHDTIYHFVSNELTHERYALVLFLSGVIIPIALSLLRLLPWPTL
WVTRFNAYVIQPPLVGTKHSTPLRGLGVMPTRGQAIFLLYLWLINIFLSLVGYDLSCRGSLWSTNQTDEMKKYVS
NRHGVLSFAHLPLLALYAGRNNVLLWLTNWSRTTFLLLHRWAAFICIIHAIVHSLIYLQMAIAREGGLDFAKVSL
NQCWTWGTVGTVAMSAILLASLQPLRQRMYEVFLISHIALAILTIIGCYYHITPRYGQAWGFQTWLYISIAIWAF
DRMVRVMRSVRGGLKRAYLTPIDDEYFRLDIPDISASGHVYLCFPTIKLWRMWESHPFSVAGVTYSKGPSHEPKC
TLKDMDGGVDHLRQTAAAGLNDTSESMVQAKDVGLVFFIRKQDGMTALLSKRGSGKNGLPVIVEGSYNPDITLLH
GNHLAPTHQFPNLICIAGGVGITGVLPALDAFSSPTHPLCRRKLYWGVRTMPLVHAVEEMLGHSCEDAADRRWGD
IDVKISVGARLGLRSLLKADLRSQNGGTVVVVCGSSSMADSVRCIVSGLARHQGENGPVLVKLVVESFAW*
Coding >Hirsu2|4295
ATGGGCCTGAGGCAGCTCAGCCTATTATCTCTCCTTCCTTACAAGGTACTTTCTGGAGCCACAAGCTATGGAGAG
GACTCCGGCCTCATCGGCTACGGCATTCAGCTGTTCCAGCCGGTCTGCGCTTTTGCTTGCCTCTTCAGCATAGCA
CCACCGCTCAACTGTTCGAGGGAAGACATGACGGCTCCGGCTCCGAAAGACAAATACACAGTGAGAGTAAAAAAT
GGTCAACTGCCTTCCGGCGAAGGATGGCATGTCACTCCCGATGCCACGCCCCAGTGCAAGCAGCATGACGACTTC
TATCTGCAGACGGTCGCCTTCTGCATACAGGCGCACTGCGAAGACGTACCCCTCATGCGATTGGAAAAGTTCTGG
GATTCGAACGTCCCTTGGCAGATGTTTAACGACAAGAAATATCAACCAGTGCCGCGACAGACTTATTCTCAGGCT
CTGGGAGCCATCAGGGACCCCCCACGGCGCCCCGTCAACAATACCGTTCTTCTCAACTATACCGCTATGGTCCCT
GAGGAAACTTATCTACGGCAGCACGATACCATTTATCATTTCGTCAGCAACGAGCTAACGCATGAGAGATACGCT
CTCGTCTTATTTCTGTCCGGTGTCATTATTCCGATCGCCCTCTCACTTCTCCGCTTGCTCCCTTGGCCTACATTG
TGGGTTACAAGATTCAATGCCTACGTCATTCAACCACCTCTTGTCGGTACTAAGCATTCTACACCGTTGCGGGGC
TTGGGAGTTATGCCGACTCGGGGTCAAGCCATTTTCCTCTTGTATCTGTGGCTCATCAACATCTTTCTCAGTCTC
GTTGGCTATGACCTGTCGTGTCGAGGAAGTCTCTGGTCCACCAATCAGACTGACGAGATGAAGAAGTACGTCTCC
AATCGCCATGGTGTGCTGAGCTTTGCTCACTTGCCCCTCCTCGCACTATACGCAGGGCGTAACAACGTTTTGCTG
TGGTTGACCAACTGGTCACGCACAACGTTTTTGCTCCTACATCGCTGGGCTGCATTTATCTGCATAATTCATGCC
ATTGTGCACAGTCTCATCTACCTCCAAATGGCAATAGCTCGCGAAGGTGGTCTTGACTTTGCCAAGGTCAGCTTG
AACCAGTGCTGGACCTGGGGTACAGTGGGCACAGTGGCCATGTCTGCCATACTCCTTGCATCCCTTCAGCCGCTT
CGACAGAGGATGTACGAGGTCTTTCTTATTAGCCACATTGCTCTGGCGATCTTGACAATCATTGGTTGCTACTAT
CATATCACTCCAAGGTACGGCCAGGCGTGGGGATTTCAAACCTGGCTGTACATCTCGATTGCTATATGGGCTTTT
GACCGCATGGTCCGTGTCATGCGCAGCGTTCGAGGCGGGCTGAAGCGTGCGTATCTAACACCTATCGATGACGAG
TATTTCCGACTTGACATCCCGGATATCTCGGCCTCAGGCCATGTGTACCTCTGCTTTCCCACGATCAAGCTCTGG
CGCATGTGGGAGAGTCATCCTTTCTCCGTTGCCGGAGTGACATACAGCAAGGGGCCATCACATGAACCCAAATGC
ACACTAAAGGATATGGACGGTGGCGTAGACCATCTAAGACAGACCGCAGCCGCTGGGCTGAATGACACGTCCGAA
TCTATGGTGCAAGCCAAGGACGTTGGGCTGGTGTTTTTCATCCGAAAGCAAGACGGTATGACAGCACTATTGTCG
AAAAGGGGCAGCGGCAAGAACGGTTTGCCCGTCATAGTCGAAGGATCCTACAATCCGGACATAACATTATTACAC
GGAAATCACCTGGCGCCGACTCATCAATTTCCAAATCTTATCTGCATTGCCGGCGGTGTCGGCATCACGGGCGTT
CTTCCAGCACTGGACGCCTTCTCGTCGCCCACGCATCCACTCTGTCGACGCAAACTGTACTGGGGCGTCCGCACA
ATGCCGCTCGTCCACGCCGTCGAAGAAATGTTGGGACACAGCTGCGAAGATGCCGCGGACAGAAGATGGGGAGAT
ATCGATGTCAAAATATCAGTTGGCGCTAGACTGGGCCTGAGGTCCCTCCTGAAGGCGGATCTGCGTTCGCAAAAC
GGCGGCACTGTTGTCGTCGTTTGCGGCTCTTCCAGTATGGCAGACAGTGTCCGTTGCATTGTTTCGGGGCTCGCC
AGACACCAAGGGGAGAATGGACCAGTTCTGGTCAAGTTGGTCGTGGAATCATTTGCATGGTGA
Transcript >Hirsu2|4295
ATGGGCCTGAGGCAGCTCAGCCTATTATCTCTCCTTCCTTACAAGGTACTTTCTGGAGCCACAAGCTATGGAGAG
GACTCCGGCCTCATCGGCTACGGCATTCAGCTGTTCCAGCCGGTCTGCGCTTTTGCTTGCCTCTTCAGCATAGCA
CCACCGCTCAACTGTTCGAGGGAAGACATGACGGCTCCGGCTCCGAAAGACAAATACACAGTGAGAGTAAAAAAT
GGTCAACTGCCTTCCGGCGAAGGATGGCATGTCACTCCCGATGCCACGCCCCAGTGCAAGCAGCATGACGACTTC
TATCTGCAGACGGTCGCCTTCTGCATACAGGCGCACTGCGAAGACGTACCCCTCATGCGATTGGAAAAGTTCTGG
GATTCGAACGTCCCTTGGCAGATGTTTAACGACAAGAAATATCAACCAGTGCCGCGACAGACTTATTCTCAGGCT
CTGGGAGCCATCAGGGACCCCCCACGGCGCCCCGTCAACAATACCGTTCTTCTCAACTATACCGCTATGGTCCCT
GAGGAAACTTATCTACGGCAGCACGATACCATTTATCATTTCGTCAGCAACGAGCTAACGCATGAGAGATACGCT
CTCGTCTTATTTCTGTCCGGTGTCATTATTCCGATCGCCCTCTCACTTCTCCGCTTGCTCCCTTGGCCTACATTG
TGGGTTACAAGATTCAATGCCTACGTCATTCAACCACCTCTTGTCGGTACTAAGCATTCTACACCGTTGCGGGGC
TTGGGAGTTATGCCGACTCGGGGTCAAGCCATTTTCCTCTTGTATCTGTGGCTCATCAACATCTTTCTCAGTCTC
GTTGGCTATGACCTGTCGTGTCGAGGAAGTCTCTGGTCCACCAATCAGACTGACGAGATGAAGAAGTACGTCTCC
AATCGCCATGGTGTGCTGAGCTTTGCTCACTTGCCCCTCCTCGCACTATACGCAGGGCGTAACAACGTTTTGCTG
TGGTTGACCAACTGGTCACGCACAACGTTTTTGCTCCTACATCGCTGGGCTGCATTTATCTGCATAATTCATGCC
ATTGTGCACAGTCTCATCTACCTCCAAATGGCAATAGCTCGCGAAGGTGGTCTTGACTTTGCCAAGGTCAGCTTG
AACCAGTGCTGGACCTGGGGTACAGTGGGCACAGTGGCCATGTCTGCCATACTCCTTGCATCCCTTCAGCCGCTT
CGACAGAGGATGTACGAGGTCTTTCTTATTAGCCACATTGCTCTGGCGATCTTGACAATCATTGGTTGCTACTAT
CATATCACTCCAAGGTACGGCCAGGCGTGGGGATTTCAAACCTGGCTGTACATCTCGATTGCTATATGGGCTTTT
GACCGCATGGTCCGTGTCATGCGCAGCGTTCGAGGCGGGCTGAAGCGTGCGTATCTAACACCTATCGATGACGAG
TATTTCCGACTTGACATCCCGGATATCTCGGCCTCAGGCCATGTGTACCTCTGCTTTCCCACGATCAAGCTCTGG
CGCATGTGGGAGAGTCATCCTTTCTCCGTTGCCGGAGTGACATACAGCAAGGGGCCATCACATGAACCCAAATGC
ACACTAAAGGATATGGACGGTGGCGTAGACCATCTAAGACAGACCGCAGCCGCTGGGCTGAATGACACGTCCGAA
TCTATGGTGCAAGCCAAGGACGTTGGGCTGGTGTTTTTCATCCGAAAGCAAGACGGTATGACAGCACTATTGTCG
AAAAGGGGCAGCGGCAAGAACGGTTTGCCCGTCATAGTCGAAGGATCCTACAATCCGGACATAACATTATTACAC
GGAAATCACCTGGCGCCGACTCATCAATTTCCAAATCTTATCTGCATTGCCGGCGGTGTCGGCATCACGGGCGTT
CTTCCAGCACTGGACGCCTTCTCGTCGCCCACGCATCCACTCTGTCGACGCAAACTGTACTGGGGCGTCCGCACA
ATGCCGCTCGTCCACGCCGTCGAAGAAATGTTGGGACACAGCTGCGAAGATGCCGCGGACAGAAGATGGGGAGAT
ATCGATGTCAAAATATCAGTTGGCGCTAGACTGGGCCTGAGGTCCCTCCTGAAGGCGGATCTGCGTTCGCAAAAC
GGCGGCACTGTTGTCGTCGTTTGCGGCTCTTCCAGTATGGCAGACAGTGTCCGTTGCATTGTTTCGGGGCTCGCC
AGACACCAAGGGGAGAATGGACCAGTTCTGGTCAAGTTGGTCGTGGAATCATTTGCATGGTGA
Gene >Hirsu2|4295
ATGGGCCTGAGGCAGCTCAGCCTATTATCTCTCCTTCCTTACAAGGTACTTTCTGGAGCCACAAGCTATGGAGAG
GACTCCGGCCTCATCGGCTACGGCATTCAGCTGTTCCAGCCGGTCTGCGCTTTTGCTTGCCTCTTCAGCATAGCA
CCACCGCTCAACTGTTCGAGGGAAGACATGACGGCTCCGGCTCCGAAAGACAAATACACAGTGAGAGTAAAAAAT
GGTCAACTGCCTTCCGGCGAAGGATGGCATGTCACTCCCGATGCCACGCCCCAGTGCAAGCAGCATGACGACTTC
TATCTGCAGACGGTCGCCTTCTGCATACAGGCGCACTGCGAAGACGTACCCCTCATGCGATTGGAAAAGTTCTGG
GATTCGAACGTCCCTTGGCAGATGTTTAACGACAAGAAATATCAACCAGTGCCGCGACAGACTTATTCTCAGGCT
CTGGGAGCCATCAGGGACCCCCCACGGCGCCCCGTCAACAATACCGTTCTTCTCAACTATACCGCTATGGTCCCT
GAGGAAACTTATCTACGGCAGCACGATACCATTTATCATTTCGTCAGCAACGAGCTAACGCATGAGAGATACGCT
CTCGTCTTATTTCTGTCCGGTGTCATTATTCCGATCGCCCTCTCACTTCTCCGCTTGCTCCCTTGGCCTACATTG
TGGGTTACAAGATTCAATGCCTACGTCATTCAACCACCTCTTGTCGGTACTAAGCATTCTACACCGTTGCGGGGC
TTGGGAGTTATGCCGACTCGGGGTCAAGCCATTTTCCTCTTGTATCTGTGGCTCATCAACATCTTTCTCAGTCTC
GTTGGCTATGACCTGTCGTGTCGAGGAAGTCTCTGGTCCACCAATCAGACTGACGAGATGAAGAAGTACGTCTCC
AATCGCCATGGTGTGCTGAGCTTTGCTCACTTGCCCCTCCTCGCACTATACGCAGGGCGTAACAACGTTTTGCTG
TGGTTGACCAACTGGTCACGCACAACGTTTTTGCTCCTACATCGCTGGGCTGCATTTATCTGCATAATTCATGCC
ATTGTGCACAGTCTCATCTACCTCCAAATGGCAATAGCTCGCGAAGGTGGTCTTGACTTTGCCAAGGTCAGCTTG
AACCAGTGCTGGACCTGGGGTACAGTGGGCACAGTGGCCATGTCTGCCATACTCCTTGCATCCCTTCAGCCGCTT
CGACAGAGGATGTACGAGGTCTTTCTTATTAGCCACATTGCTCTGGCGATCTTGACAATCATTGGTTGCTACTAT
CATATCACTCCAAGGTACGGCCAGGCGTGGGGATTTCAAACCTGGCTGTACATCTCGATTGCTATATGGGCTTTT
GACCGCATGGTCCGTGTCATGCGCAGCGTTCGAGGCGGGCTGAAGCGTGCGTATCTAACACCTATCGATGACGAG
TATTTCCGACTTGACATCCCGGATATCTCGGCCTCAGGCCATGTGTACCTCTGCTTTCCCACGATCAAGCTCTGG
CGCATGTGGGAGAGTCATCCTTTCTCCGTTGCCGGAGTGACATACAGCAAGGGGCCATCACATGAACCCAAATGC
ACACTAAAGGATATGGACGGTGGCGTAGACCATCTAAGACAGACCGCAGCCGCTGGGCTGAATGACACGTCCGAA
TCTATGGTGCAAGCCAAGGACGTTGGGCTGGTGTTTTTCATCCGAAAGCAAGACGGTATGACAGCACTATTGTCG
AAAAGGGGCAGCGGCAAGAACGGTTTGCCCGTCATAGTCGAAGGATCCTACAATCCGGACATAACATTATTACAC
GGAAATCACCTGGCGCCGACTCATCAATTTCCAAATCTTATCTGCATTGCCGGCGGTGTCGGCATCACGGGCGTT
CTTCCAGCACTGGACGCCTTCTCGTCGCCCACGCATCCACTCTGTCGACGCAAACTGTACTGGGGCGTCCGCACA
ATGCCGCTCGTCCACGCCGTCGAAGAAATGTTGGGACACAGCTGCGAAGATGCCGCGGACAGAAGATGGGGAGAT
ATCGATGTCAAAATATCAGTTGGCGCTAGACTGGGCCTGAGGTCCCTCCTGAAGGCGGATCTGCGTTCGCAAAAC
GGCGGCACTGTTGTCGTCGTTTGCGGCTCTTCCAGTATGGCAGACAGTGTCCGTTGCATTGTTTCGGGGCTCGCC
AGACACCAAGGGGAGAATGGACCAGTTCTGGTCAAGTTGGTCGTGGAATCATTTGCATGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail