Protein ID | Hirsu2|4293 |
Gene name | |
Location | Contig_22:17519..19285 |
Strand | - |
Gene length (bp) | 1766 |
Transcript length (bp) | 879 |
Coding sequence length (bp) | 879 |
Protein length (aa) | 293 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF01564 | Spermine_synth | Spermine/spermidine synthase domain | 7.9E-72 | 69 | 249 |
PF17284 | Spermine_synt_N | Spermidine synthase tetramerisation domain | 2.7E-25 | 12 | 66 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9Y8H7|SPEE_NEUCR | Spermidine synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spe-3 PE=3 SV=1 | 1 | 292 | 0.0E+00 |
sp|Q12074|SPEE_YEAST | Spermidine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPE3 PE=1 SV=1 | 3 | 292 | 6.0E-160 |
sp|Q09741|SPEE_SCHPO | Spermidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.07c PE=3 SV=1 | 1 | 288 | 3.0E-158 |
sp|P19623|SPEE_HUMAN | Spermidine synthase OS=Homo sapiens GN=SRM PE=1 SV=1 | 8 | 291 | 2.0E-127 |
sp|Q64674|SPEE_MOUSE | Spermidine synthase OS=Mus musculus GN=Srm PE=1 SV=1 | 8 | 291 | 1.0E-126 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q9Y8H7|SPEE_NEUCR | Spermidine synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spe-3 PE=3 SV=1 | 1 | 292 | 0.0E+00 |
sp|Q12074|SPEE_YEAST | Spermidine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPE3 PE=1 SV=1 | 3 | 292 | 6.0E-160 |
sp|Q09741|SPEE_SCHPO | Spermidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC12C2.07c PE=3 SV=1 | 1 | 288 | 3.0E-158 |
sp|P19623|SPEE_HUMAN | Spermidine synthase OS=Homo sapiens GN=SRM PE=1 SV=1 | 8 | 291 | 2.0E-127 |
sp|Q64674|SPEE_MOUSE | Spermidine synthase OS=Mus musculus GN=Srm PE=1 SV=1 | 8 | 291 | 1.0E-126 |
sp|Q12455|SPSY_YEAST | Spermine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPE4 PE=1 SV=1 | 6 | 292 | 1.0E-109 |
sp|Q9XY92|SPEE_DICDI | Spermidine synthase OS=Dictyostelium discoideum GN=spsA PE=3 SV=2 | 9 | 292 | 2.0E-108 |
sp|Q96557|SPD2_DATST | Spermidine synthase 2 OS=Datura stramonium PE=2 SV=1 | 8 | 292 | 3.0E-104 |
sp|Q9ZS45|SPDE_SOLLC | Spermidine synthase OS=Solanum lycopersicum GN=SPDSYN PE=2 SV=1 | 8 | 292 | 5.0E-104 |
sp|O48660|SPDE_NICSY | Spermidine synthase OS=Nicotiana sylvestris PE=2 SV=1 | 8 | 292 | 3.0E-102 |
sp|O48658|SPD1_HYONI | Spermidine synthase 1 OS=Hyoscyamus niger PE=2 SV=1 | 8 | 292 | 4.0E-102 |
sp|Q9ZTR1|SPD1_PEA | Spermidine synthase 1 OS=Pisum sativum GN=SPDSYN1 PE=2 SV=1 | 8 | 291 | 9.0E-101 |
sp|Q9ZUB3|SPD1_ARATH | Spermidine synthase 1 OS=Arabidopsis thaliana GN=SPDSYN1 PE=1 SV=1 | 8 | 292 | 1.0E-100 |
sp|O48661|SPD2_ARATH | Spermidine synthase 2 OS=Arabidopsis thaliana GN=SPDSYN2 PE=1 SV=2 | 3 | 291 | 2.0E-100 |
sp|Q96556|SPD1_DATST | Spermidine synthase 1 OS=Datura stramonium PE=2 SV=1 | 8 | 292 | 3.0E-100 |
sp|Q9ZTR0|SPD2_PEA | Spermidine synthase 2 OS=Pisum sativum GN=SPDSYN2 PE=2 SV=1 | 12 | 291 | 3.0E-100 |
sp|Q9SMB1|SPD1_ORYSJ | Spermidine synthase 1 OS=Oryza sativa subsp. japonica GN=SPDSYN1 PE=2 SV=1 | 12 | 291 | 5.0E-100 |
sp|O82147|SPDE_COFAR | Spermidine synthase OS=Coffea arabica PE=2 SV=1 | 8 | 291 | 6.0E-100 |
sp|O48659|SPD2_HYONI | Spermidine synthase 2 OS=Hyoscyamus niger PE=2 SV=1 | 8 | 292 | 8.0E-100 |
sp|Q9SEH5|PMT3_TOBAC | Putrescine N-methyltransferase 3 OS=Nicotiana tabacum GN=PMT3 PE=3 SV=1 | 8 | 292 | 1.0E-81 |
sp|Q9SEH7|PMT2_TOBAC | Putrescine N-methyltransferase 2 OS=Nicotiana tabacum GN=PMT2 PE=3 SV=1 | 9 | 292 | 2.0E-81 |
sp|Q8EXA3|SPEE2_LEPIN | Polyamine aminopropyltransferase 2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=speE2 PE=3 SV=2 | 13 | 291 | 6.0E-81 |
sp|Q42963|PMT1_TOBAC | Putrescine N-methyltransferase 1 OS=Nicotiana tabacum GN=PMT1 PE=2 SV=1 | 8 | 292 | 8.0E-81 |
sp|Q9SEH4|PMT4_TOBAC | Putrescine N-methyltransferase 4 OS=Nicotiana tabacum GN=PMT4 PE=3 SV=1 | 8 | 292 | 8.0E-79 |
sp|B0STV8|SPEE_LEPBP | Polyamine aminopropyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=speE PE=3 SV=1 | 13 | 292 | 2.0E-78 |
sp|B0SI93|SPEE_LEPBA | Polyamine aminopropyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=speE PE=3 SV=1 | 13 | 292 | 2.0E-78 |
sp|Q8RA94|SPEE1_CALS4 | Polyamine aminopropyltransferase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=speE1 PE=3 SV=1 | 13 | 288 | 4.0E-73 |
sp|A3DDA0|SPEE_CLOTH | Polyamine aminopropyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=speE PE=3 SV=1 | 13 | 292 | 6.0E-73 |
sp|Q94BN2|SPSY_ARATH | Spermine synthase OS=Arabidopsis thaliana GN=SPMS PE=1 SV=1 | 6 | 289 | 7.0E-73 |
sp|B0K172|SPEE_THEPX | Polyamine aminopropyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=speE PE=3 SV=1 | 13 | 288 | 1.0E-71 |
sp|B0K9I5|SPEE_THEP3 | Polyamine aminopropyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=speE PE=3 SV=1 | 13 | 288 | 1.0E-71 |
sp|B1I5Z0|SPEE_DESAP | Polyamine aminopropyltransferase OS=Desulforudis audaxviator (strain MP104C) GN=speE PE=3 SV=1 | 13 | 286 | 4.0E-69 |
sp|A5N219|SPEE_CLOK5 | Polyamine aminopropyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=speE PE=3 SV=1 | 11 | 288 | 5.0E-69 |
sp|B9E5S1|SPEE_CLOK1 | Polyamine aminopropyltransferase OS=Clostridium kluyveri (strain NBRC 12016) GN=speE PE=3 SV=1 | 11 | 288 | 5.0E-69 |
sp|O66473|SPEE1_AQUAE | Polyamine aminopropyltransferase 1 OS=Aquifex aeolicus (strain VF5) GN=speE1 PE=3 SV=1 | 30 | 292 | 1.0E-63 |
sp|B9KAY3|SPEE_THENN | Polyamine aminopropyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=speE PE=3 SV=1 | 25 | 291 | 1.0E-61 |
sp|Q5WB31|SPEE_BACSK | Polyamine aminopropyltransferase OS=Bacillus clausii (strain KSM-K16) GN=speE PE=3 SV=1 | 13 | 292 | 2.0E-61 |
sp|Q9WZC2|SPEE_THEMA | Polyamine aminopropyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=speE PE=1 SV=1 | 25 | 291 | 2.0E-61 |
sp|Q2RHH3|SPEE_MOOTA | Polyamine aminopropyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=speE PE=3 SV=1 | 13 | 288 | 2.0E-61 |
sp|A5IJD3|SPEE_THEP1 | Polyamine aminopropyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=speE PE=3 SV=1 | 25 | 291 | 2.0E-61 |
sp|A4XKM9|SPEE_CALS8 | Polyamine aminopropyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=speE PE=3 SV=1 | 13 | 292 | 4.0E-61 |
sp|Q814Q1|SPEE1_BACCR | Polyamine aminopropyltransferase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=speE1 PE=3 SV=1 | 13 | 287 | 6.0E-60 |
sp|B9MRW0|SPEE_CALBD | Polyamine aminopropyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=speE PE=3 SV=1 | 13 | 292 | 3.0E-59 |
sp|Q9K6B8|SPEE_BACHD | Polyamine aminopropyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=speE PE=3 SV=1 | 25 | 287 | 8.0E-59 |
sp|P70998|SPEE_BACSU | Polyamine aminopropyltransferase OS=Bacillus subtilis (strain 168) GN=speE PE=1 SV=1 | 17 | 292 | 1.0E-58 |
sp|B4U8W2|SPEE_HYDS0 | Polyamine aminopropyltransferase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=speE PE=3 SV=1 | 9 | 292 | 4.0E-58 |
sp|Q6D1W4|SPEE_PECAS | Polyamine aminopropyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=speE PE=3 SV=1 | 28 | 292 | 7.0E-58 |
sp|A7GVB2|SPEE_BACCN | Polyamine aminopropyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=speE PE=3 SV=1 | 13 | 287 | 7.0E-58 |
sp|C6DC58|SPEE_PECCP | Polyamine aminopropyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=speE PE=3 SV=1 | 28 | 292 | 1.0E-57 |
sp|Q891W4|SPEE_CLOTE | Polyamine aminopropyltransferase OS=Clostridium tetani (strain Massachusetts / E88) GN=speE PE=3 SV=1 | 11 | 291 | 2.0E-57 |
sp|Q57761|SPEE_METJA | Polyamine aminopropyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=speE PE=3 SV=1 | 13 | 292 | 1.0E-56 |
sp|Q72X78|SPEE_BACC1 | Polyamine aminopropyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=speE PE=3 SV=1 | 13 | 287 | 2.0E-56 |
sp|Q81JT0|SPEE1_BACAN | Polyamine aminopropyltransferase 1 OS=Bacillus anthracis GN=speE1 PE=3 SV=1 | 13 | 287 | 2.0E-56 |
sp|Q0SVK7|SPEE_CLOPS | Polyamine aminopropyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=speE PE=3 SV=1 | 26 | 292 | 3.0E-56 |
sp|Q8XMY8|SPEE_CLOPE | Polyamine aminopropyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=speE PE=3 SV=1 | 26 | 292 | 3.0E-56 |
sp|A9VSG3|SPEE_BACWK | Polyamine aminopropyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=speE PE=3 SV=1 | 13 | 287 | 4.0E-56 |
sp|Q0TTQ7|SPEE_CLOP1 | Polyamine aminopropyltransferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=speE PE=3 SV=1 | 26 | 292 | 1.0E-55 |
sp|Q8Z9E2|SPEE_SALTI | Polyamine aminopropyltransferase OS=Salmonella typhi GN=speE PE=3 SV=1 | 13 | 291 | 5.0E-55 |
sp|A9MZR2|SPEE_SALPB | Polyamine aminopropyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=speE PE=3 SV=1 | 13 | 291 | 8.0E-55 |
sp|B5BL97|SPEE_SALPK | Polyamine aminopropyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=speE PE=3 SV=1 | 13 | 291 | 1.0E-54 |
sp|Q5PDA0|SPEE_SALPA | Polyamine aminopropyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=speE PE=3 SV=1 | 13 | 291 | 1.0E-54 |
sp|Q8ZRS3|SPEE_SALTY | Polyamine aminopropyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=speE PE=3 SV=1 | 13 | 291 | 1.0E-54 |
sp|C0Q5M7|SPEE_SALPC | Polyamine aminopropyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=speE PE=3 SV=1 | 13 | 291 | 1.0E-54 |
sp|B4TJD2|SPEE_SALHS | Polyamine aminopropyltransferase OS=Salmonella heidelberg (strain SL476) GN=speE PE=3 SV=1 | 13 | 291 | 1.0E-54 |
sp|B5RHA5|SPEE_SALG2 | Polyamine aminopropyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=speE PE=3 SV=1 | 13 | 291 | 1.0E-54 |
sp|B5R2R5|SPEE_SALEP | Polyamine aminopropyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=speE PE=3 SV=1 | 13 | 291 | 1.0E-54 |
sp|B5FIB4|SPEE_SALDC | Polyamine aminopropyltransferase OS=Salmonella dublin (strain CT_02021853) GN=speE PE=3 SV=1 | 13 | 291 | 1.0E-54 |
sp|Q57T89|SPEE_SALCH | Polyamine aminopropyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=speE PE=3 SV=1 | 13 | 291 | 1.0E-54 |
sp|B5F815|SPEE_SALA4 | Polyamine aminopropyltransferase OS=Salmonella agona (strain SL483) GN=speE PE=3 SV=1 | 13 | 291 | 1.0E-54 |
sp|A8ALG8|SPEE_CITK8 | Polyamine aminopropyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=speE PE=3 SV=1 | 13 | 291 | 2.0E-54 |
sp|Q3Z5N9|SPEE_SHISS | Polyamine aminopropyltransferase OS=Shigella sonnei (strain Ss046) GN=speE PE=3 SV=1 | 10 | 291 | 2.0E-54 |
sp|A9MPN3|SPEE_SALAR | Polyamine aminopropyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=speE PE=3 SV=1 | 13 | 291 | 2.0E-54 |
sp|Q83MF0|SPEE_SHIFL | Polyamine aminopropyltransferase OS=Shigella flexneri GN=speE PE=3 SV=3 | 10 | 291 | 2.0E-54 |
sp|Q0T879|SPEE_SHIF8 | Polyamine aminopropyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=speE PE=3 SV=1 | 10 | 291 | 2.0E-54 |
sp|B4TXL7|SPEE_SALSV | Polyamine aminopropyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=speE PE=3 SV=1 | 13 | 291 | 2.0E-54 |
sp|B1LGS2|SPEE_ECOSM | Polyamine aminopropyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=speE PE=3 SV=1 | 10 | 291 | 3.0E-54 |
sp|B6HZ96|SPEE_ECOSE | Polyamine aminopropyltransferase OS=Escherichia coli (strain SE11) GN=speE PE=3 SV=1 | 10 | 291 | 3.0E-54 |
sp|P09158|SPEE_ECOLI | Polyamine aminopropyltransferase OS=Escherichia coli (strain K12) GN=speE PE=1 SV=2 | 10 | 291 | 3.0E-54 |
sp|B1IQL9|SPEE_ECOLC | Polyamine aminopropyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=speE PE=3 SV=1 | 10 | 291 | 3.0E-54 |
sp|A7ZW70|SPEE_ECOHS | Polyamine aminopropyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=speE PE=3 SV=1 | 10 | 291 | 3.0E-54 |
sp|B1XC96|SPEE_ECODH | Polyamine aminopropyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=speE PE=3 SV=1 | 10 | 291 | 3.0E-54 |
sp|C4ZRL4|SPEE_ECOBW | Polyamine aminopropyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=speE PE=3 SV=1 | 10 | 291 | 3.0E-54 |
sp|B7M162|SPEE_ECO8A | Polyamine aminopropyltransferase OS=Escherichia coli O8 (strain IAI1) GN=speE PE=3 SV=1 | 10 | 291 | 3.0E-54 |
sp|B7LFY8|SPEE_ECO55 | Polyamine aminopropyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=speE PE=3 SV=1 | 10 | 291 | 3.0E-54 |
sp|A7ZHL0|SPEE_ECO24 | Polyamine aminopropyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=speE PE=3 SV=1 | 10 | 291 | 3.0E-54 |
sp|B5Y1R1|SPEE_KLEP3 | Polyamine aminopropyltransferase OS=Klebsiella pneumoniae (strain 342) GN=speE PE=3 SV=1 | 13 | 291 | 3.0E-54 |
sp|Q884N3|SPEE_PSESM | Polyamine aminopropyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=speE PE=3 SV=1 | 20 | 292 | 3.0E-54 |
sp|Q1RG70|SPEE_ECOUT | Polyamine aminopropyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=speE PE=3 SV=1 | 10 | 291 | 4.0E-54 |
sp|A1A7G7|SPEE_ECOK1 | Polyamine aminopropyltransferase OS=Escherichia coli O1:K1 / APEC GN=speE PE=3 SV=1 | 10 | 291 | 4.0E-54 |
sp|B7MBA4|SPEE_ECO45 | Polyamine aminopropyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=speE PE=3 SV=1 | 10 | 291 | 4.0E-54 |
sp|B7UIG9|SPEE_ECO27 | Polyamine aminopropyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=speE PE=3 SV=1 | 10 | 291 | 4.0E-54 |
sp|B7N7Z1|SPEE_ECOLU | Polyamine aminopropyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=speE PE=3 SV=1 | 10 | 291 | 5.0E-54 |
sp|P66833|SPEE_ECOL6 | Polyamine aminopropyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=speE PE=3 SV=2 | 10 | 291 | 5.0E-54 |
sp|Q0TLL3|SPEE_ECOL5 | Polyamine aminopropyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=speE PE=3 SV=1 | 10 | 291 | 5.0E-54 |
sp|B7NI81|SPEE_ECO7I | Polyamine aminopropyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=speE PE=3 SV=1 | 10 | 291 | 5.0E-54 |
sp|B5YZF6|SPEE_ECO5E | Polyamine aminopropyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=speE PE=3 SV=1 | 10 | 291 | 5.0E-54 |
sp|P66834|SPEE_ECO57 | Polyamine aminopropyltransferase OS=Escherichia coli O157:H7 GN=speE PE=3 SV=2 | 10 | 291 | 5.0E-54 |
sp|Q606H1|SPEE_METCA | Polyamine aminopropyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=speE PE=3 SV=1 | 13 | 292 | 5.0E-54 |
sp|B2U2X0|SPEE_SHIB3 | Polyamine aminopropyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=speE PE=3 SV=1 | 10 | 291 | 5.0E-54 |
sp|Q7N892|SPEE_PHOLL | Polyamine aminopropyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=speE PE=3 SV=1 | 28 | 291 | 5.0E-54 |
sp|Q9X6R0|SPEE1_PSEAE | Polyamine aminopropyltransferase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=speE1 PE=3 SV=2 | 20 | 291 | 6.0E-54 |
sp|B7LVY5|SPEE_ESCF3 | Polyamine aminopropyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=speE PE=3 SV=1 | 10 | 291 | 7.0E-54 |
sp|B4SU91|SPEE_SALNS | Polyamine aminopropyltransferase OS=Salmonella newport (strain SL254) GN=speE PE=3 SV=1 | 13 | 291 | 7.0E-54 |
sp|A6T4R6|SPEE_KLEP7 | Polyamine aminopropyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=speE PE=3 SV=1 | 13 | 291 | 1.0E-53 |
sp|Q2NVS1|SPEE_SODGM | Polyamine aminopropyltransferase OS=Sodalis glossinidius (strain morsitans) GN=speE PE=3 SV=1 | 10 | 291 | 3.0E-53 |
sp|B7MNY3|SPEE_ECO81 | Polyamine aminopropyltransferase OS=Escherichia coli O81 (strain ED1a) GN=speE PE=3 SV=1 | 10 | 291 | 4.0E-53 |
sp|A8GJ06|SPEE_SERP5 | Polyamine aminopropyltransferase OS=Serratia proteamaculans (strain 568) GN=speE PE=3 SV=1 | 8 | 292 | 6.0E-53 |
sp|A4W6M6|SPEE_ENT38 | Polyamine aminopropyltransferase OS=Enterobacter sp. (strain 638) GN=speE PE=3 SV=1 | 13 | 291 | 8.0E-53 |
sp|Q32K90|SPEE_SHIDS | Polyamine aminopropyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=speE PE=3 SV=1 | 10 | 291 | 1.0E-52 |
sp|Q66EH3|SPEE_YERPS | Polyamine aminopropyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=speE PE=3 SV=1 | 10 | 291 | 2.0E-52 |
sp|B2K4I2|SPEE_YERPB | Polyamine aminopropyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=speE PE=3 SV=1 | 10 | 291 | 2.0E-52 |
sp|A7FM33|SPEE_YERP3 | Polyamine aminopropyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=speE PE=3 SV=1 | 10 | 291 | 2.0E-52 |
sp|B1JK45|SPEE_YERPY | Polyamine aminopropyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=speE PE=3 SV=1 | 10 | 291 | 2.0E-52 |
sp|Q326B5|SPEE_SHIBS | Polyamine aminopropyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=speE PE=3 SV=1 | 10 | 291 | 2.0E-52 |
sp|Q3JDL8|SPEE_NITOC | Polyamine aminopropyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=speE PE=3 SV=1 | 12 | 289 | 3.0E-52 |
sp|A8MLM9|SPEE_ALKOO | Polyamine aminopropyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=speE PE=3 SV=1 | 26 | 287 | 5.0E-52 |
sp|A4TPU4|SPEE_YERPP | Polyamine aminopropyltransferase OS=Yersinia pestis (strain Pestoides F) GN=speE PE=3 SV=1 | 10 | 291 | 6.0E-52 |
sp|Q1CLX1|SPEE_YERPN | Polyamine aminopropyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=speE PE=3 SV=1 | 10 | 291 | 6.0E-52 |
sp|A9R1H4|SPEE_YERPG | Polyamine aminopropyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=speE PE=3 SV=1 | 10 | 291 | 6.0E-52 |
sp|Q8ZBJ8|SPEE_YERPE | Polyamine aminopropyltransferase OS=Yersinia pestis GN=speE PE=3 SV=1 | 10 | 291 | 6.0E-52 |
sp|Q1C3U7|SPEE_YERPA | Polyamine aminopropyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=speE PE=3 SV=1 | 10 | 291 | 6.0E-52 |
sp|A9KQ99|SPEE_CLOPH | Polyamine aminopropyltransferase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=speE PE=3 SV=1 | 26 | 291 | 7.0E-52 |
sp|A1JJM8|SPEE_YERE8 | Polyamine aminopropyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=speE PE=3 SV=1 | 10 | 291 | 1.0E-51 |
sp|B2VD21|SPEE_ERWT9 | Polyamine aminopropyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=speE PE=3 SV=1 | 18 | 291 | 1.0E-51 |
sp|B8GQ45|SPEE_THISH | Polyamine aminopropyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=speE PE=3 SV=1 | 8 | 291 | 9.0E-51 |
sp|B2TMY2|SPEE_CLOBB | Polyamine aminopropyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=speE PE=3 SV=1 | 26 | 287 | 3.0E-50 |
sp|Q3BN93|SPEE_XANC5 | Polyamine aminopropyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=speE PE=3 SV=1 | 8 | 291 | 4.0E-50 |
sp|B2V328|SPEE_CLOBA | Polyamine aminopropyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=speE PE=3 SV=1 | 26 | 287 | 4.0E-50 |
sp|Q5H6E7|SPEE_XANOR | Polyamine aminopropyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=speE PE=3 SV=1 | 8 | 291 | 6.0E-50 |
sp|B2SHF6|SPEE_XANOP | Polyamine aminopropyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=speE PE=3 SV=1 | 8 | 291 | 6.0E-50 |
sp|Q2P928|SPEE_XANOM | Polyamine aminopropyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=speE PE=3 SV=1 | 8 | 291 | 6.0E-50 |
sp|Q8PFQ4|SPEE_XANAC | Polyamine aminopropyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=speE PE=3 SV=1 | 8 | 291 | 6.0E-50 |
sp|A1WZR2|SPEE_HALHL | Polyamine aminopropyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=speE PE=3 SV=1 | 9 | 288 | 1.0E-49 |
sp|A6M1N9|SPEE_CLOB8 | Polyamine aminopropyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=speE PE=3 SV=1 | 26 | 292 | 1.0E-49 |
sp|Q18A85|SPEE_PEPD6 | Polyamine aminopropyltransferase OS=Peptoclostridium difficile (strain 630) GN=speE PE=3 SV=1 | 26 | 291 | 1.0E-49 |
sp|A6TRI3|SPEE_ALKMQ | Polyamine aminopropyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=speE PE=3 SV=1 | 26 | 292 | 2.0E-49 |
sp|Q8P447|SPEE_XANCP | Polyamine aminopropyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=speE PE=3 SV=1 | 8 | 291 | 7.0E-49 |
sp|B0RXN7|SPEE_XANCB | Polyamine aminopropyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=speE PE=3 SV=1 | 8 | 291 | 7.0E-49 |
sp|Q4UPN0|SPEE_XANC8 | Polyamine aminopropyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=speE PE=3 SV=1 | 8 | 291 | 7.0E-49 |
sp|Q9PH03|SPEE_XYLFA | Polyamine aminopropyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=speE PE=3 SV=1 | 8 | 291 | 8.0E-48 |
sp|Q0ACK7|SPEE_ALKEH | Polyamine aminopropyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=speE PE=3 SV=1 | 11 | 291 | 1.0E-47 |
sp|Q87F26|SPEE_XYLFT | Polyamine aminopropyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=speE PE=3 SV=1 | 8 | 291 | 1.0E-47 |
sp|B2I6M0|SPEE_XYLF2 | Polyamine aminopropyltransferase OS=Xylella fastidiosa (strain M23) GN=speE PE=3 SV=1 | 8 | 291 | 1.0E-47 |
sp|B0U1H5|SPEE_XYLFM | Polyamine aminopropyltransferase OS=Xylella fastidiosa (strain M12) GN=speE PE=3 SV=1 | 8 | 291 | 1.0E-47 |
sp|B6YXJ9|SPEE_THEON | Polyamine aminopropyltransferase OS=Thermococcus onnurineus (strain NA1) GN=speE PE=3 SV=1 | 23 | 292 | 1.0E-47 |
sp|Q8U4G1|SPEE_PYRFU | Polyamine aminopropyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=speE PE=1 SV=1 | 15 | 292 | 1.0E-46 |
sp|Q5JFG9|SPEE_THEKO | Polyamine aminopropyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=speE PE=1 SV=1 | 15 | 292 | 2.0E-46 |
sp|P66836|SPEE_STRR6 | Polyamine aminopropyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=speE PE=3 SV=1 | 11 | 292 | 3.0E-46 |
sp|P66835|SPEE_STRPN | Polyamine aminopropyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=speE PE=3 SV=1 | 11 | 292 | 3.0E-46 |
sp|Q97FX3|SPEE_CLOAB | Polyamine aminopropyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=speE PE=3 SV=1 | 19 | 292 | 4.0E-46 |
sp|Q8K9T5|SPEE_BUCAP | Polyamine aminopropyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=speE PE=3 SV=1 | 28 | 291 | 3.0E-45 |
sp|C4K3X3|SPEE_HAMD5 | Polyamine aminopropyltransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=speE PE=3 SV=1 | 10 | 291 | 7.0E-45 |
sp|C4Z1Q7|SPEE_EUBE2 | Polyamine aminopropyltransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=speE PE=3 SV=1 | 13 | 287 | 4.0E-44 |
sp|O27950|SPEE_ARCFU | Polyamine aminopropyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=speE PE=3 SV=1 | 13 | 292 | 5.0E-44 |
sp|B2FKR1|SPEE_STRMK | Polyamine aminopropyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=speE PE=3 SV=1 | 23 | 292 | 6.0E-44 |
sp|A2BIX4|SPEE1_HYPBU | Polyamine aminopropyltransferase 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=speE1 PE=1 SV=1 | 30 | 235 | 9.0E-44 |
sp|Q9V277|SPEE_PYRAB | Polyamine aminopropyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=speE PE=3 SV=1 | 16 | 292 | 1.0E-43 |
sp|B4SM23|SPEE_STRM5 | Polyamine aminopropyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=speE PE=3 SV=1 | 23 | 292 | 1.0E-43 |
sp|B9DUY3|SPEE_STRU0 | Polyamine aminopropyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=speE PE=3 SV=1 | 11 | 291 | 4.0E-43 |
sp|Q5N3N4|SPEE_SYNP6 | Polyamine aminopropyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=speE PE=3 SV=1 | 32 | 291 | 3.0E-42 |
sp|Q31QK9|SPEE_SYNE7 | Polyamine aminopropyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=speE PE=3 SV=1 | 32 | 291 | 3.0E-42 |
sp|Q1GGU4|SPEE_RUEST | Polyamine aminopropyltransferase OS=Ruegeria sp. (strain TM1040) GN=speE PE=3 SV=1 | 25 | 289 | 1.0E-39 |
sp|Q9YE02|SPEE_AERPE | Polyamine aminopropyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=speE PE=3 SV=2 | 9 | 248 | 3.0E-39 |
sp|Q5SK28|SPEE_THET8 | Polyamine aminopropyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=speE PE=1 SV=1 | 22 | 246 | 4.0E-39 |
sp|Q72K55|SPEE_THET2 | Polyamine aminopropyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=speE PE=3 SV=1 | 22 | 246 | 4.0E-39 |
sp|Q8ZXM4|SPEE_PYRAE | Polyamine aminopropyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=speE PE=1 SV=1 | 25 | 288 | 5.0E-39 |
sp|A4WHN0|SPEE_PYRAR | Polyamine aminopropyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=speE PE=3 SV=1 | 25 | 288 | 6.0E-39 |
sp|C4ZDU4|SPEE_EUBR3 | Polyamine aminopropyltransferase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=speE PE=3 SV=1 | 20 | 292 | 9.0E-39 |
sp|Q0I685|SPEE_SYNS3 | Polyamine aminopropyltransferase OS=Synechococcus sp. (strain CC9311) GN=speE PE=3 SV=1 | 32 | 292 | 3.0E-38 |
sp|A3MU81|SPEE_PYRCJ | Polyamine aminopropyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=speE PE=3 SV=1 | 25 | 227 | 3.0E-38 |
sp|Q9HL75|SPEE_THEAC | Polyamine aminopropyltransferase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=speE PE=3 SV=1 | 11 | 291 | 4.0E-37 |
sp|B1YB61|SPEE_PYRNV | Polyamine aminopropyltransferase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=speE PE=3 SV=1 | 24 | 284 | 6.0E-37 |
sp|A1RU43|SPEE_PYRIL | Polyamine aminopropyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=speE PE=3 SV=1 | 26 | 288 | 8.0E-37 |
sp|Q6L1F4|SPEE_PICTO | Polyamine aminopropyltransferase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=speE PE=3 SV=1 | 11 | 292 | 1.0E-36 |
sp|A2BTR7|SPEE_PROMS | Polyamine aminopropyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=speE PE=3 SV=1 | 32 | 291 | 1.0E-36 |
sp|Q97BN7|SPEE_THEVO | Polyamine aminopropyltransferase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=speE PE=3 SV=1 | 11 | 288 | 3.0E-36 |
sp|Q9HV34|SPEE2_PSEAE | Polyamine aminopropyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=speE2 PE=3 SV=1 | 11 | 246 | 3.0E-36 |
sp|Q9S7X6|ACL5_ARATH | Thermospermine synthase ACAULIS5 OS=Arabidopsis thaliana GN=ACL5 PE=1 SV=1 | 13 | 235 | 8.0E-36 |
sp|Q82XD4|SPEE_NITEU | Polyamine aminopropyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=speE PE=3 SV=1 | 17 | 292 | 4.0E-35 |
sp|A3PFH4|SPEE_PROM0 | Polyamine aminopropyltransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=speE PE=3 SV=1 | 33 | 291 | 5.0E-35 |
sp|Q7V3X3|SPEE_PROMM | Polyamine aminopropyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=speE PE=3 SV=2 | 32 | 291 | 8.0E-35 |
sp|Q7V9I5|SPEE_PROMA | Polyamine aminopropyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=speE PE=3 SV=1 | 28 | 292 | 1.0E-34 |
sp|A2CDX0|SPEE_PROM3 | Polyamine aminopropyltransferase OS=Prochlorococcus marinus (strain MIT 9303) GN=speE PE=3 SV=1 | 32 | 291 | 3.0E-34 |
sp|Q2JQS1|SPEE_SYNJA | Polyamine aminopropyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=speE PE=3 SV=1 | 13 | 248 | 6.0E-34 |
sp|Q975S5|SPEE_SULTO | Polyamine aminopropyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=speE PE=3 SV=1 | 23 | 292 | 2.0E-33 |
sp|Q7U3L0|SPEE_SYNPX | Polyamine aminopropyltransferase OS=Synechococcus sp. (strain WH8102) GN=speE PE=3 SV=1 | 33 | 291 | 2.0E-33 |
sp|Q2JQ57|SPEE_SYNJB | Polyamine aminopropyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=speE PE=3 SV=1 | 13 | 248 | 2.0E-33 |
sp|Q317V6|SPEE_PROM9 | Polyamine aminopropyltransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=speE PE=3 SV=1 | 32 | 292 | 4.0E-33 |
sp|B1L5H2|SPEE_KORCO | Polyamine aminopropyltransferase OS=Korarchaeum cryptofilum (strain OPF8) GN=speE PE=3 SV=1 | 11 | 292 | 5.0E-33 |
sp|B8D7B3|SPEE_BUCAT | Polyamine aminopropyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=speE PE=3 SV=1 | 30 | 292 | 6.0E-33 |
sp|P57305|SPEE_BUCAI | Polyamine aminopropyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=speE PE=3 SV=1 | 30 | 292 | 6.0E-33 |
sp|B8D908|SPEE_BUCA5 | Polyamine aminopropyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=speE PE=3 SV=1 | 30 | 292 | 6.0E-33 |
sp|A2BJU2|SPEE2_HYPBU | Polyamine aminopropyltransferase 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=speE2 PE=1 SV=1 | 23 | 291 | 3.0E-32 |
sp|Q9UXE4|SPEE_SULSO | Polyamine aminopropyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=speE PE=1 SV=1 | 30 | 292 | 4.0E-32 |
sp|O57950|SPEE_PYRHO | Polyamine aminopropyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=speE PE=1 SV=1 | 16 | 291 | 3.0E-31 |
sp|C3NHE1|SPEE_SULIN | Polyamine aminopropyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=speE PE=3 SV=1 | 30 | 292 | 3.0E-30 |
sp|C3NEA8|SPEE_SULIY | Polyamine aminopropyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=speE PE=3 SV=1 | 30 | 292 | 3.0E-30 |
sp|C3MVE5|SPEE_SULIM | Polyamine aminopropyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=speE PE=3 SV=1 | 30 | 292 | 3.0E-30 |
sp|C3MQ26|SPEE_SULIL | Polyamine aminopropyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=speE PE=3 SV=1 | 30 | 292 | 3.0E-30 |
sp|C4KHC0|SPEE_SULIK | Polyamine aminopropyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=speE PE=3 SV=1 | 30 | 292 | 3.0E-30 |
sp|C3N5P4|SPEE_SULIA | Polyamine aminopropyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=speE PE=3 SV=1 | 30 | 292 | 3.0E-30 |
sp|Q4JAZ8|SPEE_SULAC | Polyamine aminopropyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=speE PE=3 SV=1 | 30 | 292 | 7.0E-29 |
sp|Q7UZI0|SPEE_PROMP | Polyamine aminopropyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=speE PE=3 SV=1 | 32 | 292 | 5.0E-27 |
sp|A2BZ72|SPEE_PROM5 | Polyamine aminopropyltransferase OS=Prochlorococcus marinus (strain MIT 9515) GN=speE PE=3 SV=1 | 32 | 292 | 7.0E-27 |
sp|Q8R977|SPEE2_CALS4 | Polyamine aminopropyltransferase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=speE2 PE=3 SV=1 | 23 | 291 | 8.0E-26 |
sp|A8G7J0|SPEE_PROM2 | Polyamine aminopropyltransferase OS=Prochlorococcus marinus (strain MIT 9215) GN=speE PE=3 SV=1 | 32 | 291 | 2.0E-25 |
sp|Q72V65|SPEE_LEPIC | Polyamine aminopropyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=speE PE=3 SV=1 | 27 | 291 | 2.0E-25 |
sp|Q8EZP1|SPEE1_LEPIN | Polyamine aminopropyltransferase 1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=speE1 PE=3 SV=1 | 27 | 291 | 1.0E-24 |
sp|Q46IA2|SPEE_PROMT | Polyamine aminopropyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=speE PE=3 SV=1 | 32 | 291 | 2.0E-23 |
sp|A2C5F4|SPEE_PROM1 | Polyamine aminopropyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=speE PE=3 SV=1 | 10 | 291 | 3.0E-23 |
sp|Q9L091|SPEE1_STRCO | Polyamine aminopropyltransferase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=speE1 PE=3 SV=1 | 31 | 284 | 5.0E-23 |
sp|Q8CV14|SPEE_OCEIH | Polyamine aminopropyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=speE PE=3 SV=1 | 17 | 290 | 1.0E-21 |
sp|Q815E8|SPEE2_BACCR | Polyamine aminopropyltransferase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=speE2 PE=3 SV=1 | 34 | 201 | 3.0E-18 |
sp|Q8XQC8|SPEE1_RALSO | Polyamine aminopropyltransferase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=speE1 PE=3 SV=1 | 31 | 246 | 5.0E-18 |
sp|Q8XQC5|SPEE2_RALSO | Polyamine aminopropyltransferase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=speE2 PE=3 SV=1 | 31 | 246 | 5.0E-18 |
sp|Q7UWD1|SPEE_RHOBA | Polyamine aminopropyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=speE PE=3 SV=1 | 32 | 199 | 1.0E-17 |
sp|P9WGE5|SPEE_MYCTU | Polyamine aminopropyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=speE PE=3 SV=1 | 28 | 277 | 2.0E-17 |
sp|P9WGE4|SPEE_MYCTO | Polyamine aminopropyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=speE PE=3 SV=1 | 28 | 277 | 2.0E-17 |
sp|Q7TY95|SPEE_MYCBO | Polyamine aminopropyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=speE PE=3 SV=1 | 28 | 277 | 2.0E-17 |
sp|O67365|SPEE2_AQUAE | Polyamine aminopropyltransferase 2 OS=Aquifex aeolicus (strain VF5) GN=speE2 PE=3 SV=1 | 31 | 248 | 3.0E-16 |
sp|Q81X05|SPEE2_BACAN | Polyamine aminopropyltransferase 2 OS=Bacillus anthracis GN=speE2 PE=3 SV=1 | 34 | 201 | 7.0E-16 |
sp|Q82EU4|SPEE_STRAW | Polyamine aminopropyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=speE PE=3 SV=1 | 56 | 260 | 2.0E-12 |
sp|Q8FMF7|SPEE_COREF | Polyamine aminopropyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=speE PE=3 SV=1 | 31 | 275 | 3.0E-11 |
sp|Q9X8S2|SPEE2_STRCO | Polyamine aminopropyltransferase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=speE2 PE=3 SV=1 | 38 | 190 | 4.0E-10 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 14 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|4293 MSEIAHPTIKDGWFREISDMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTDHGTVLVLDNVIQCTERDEFSYQEM ITHLAMNSHPNPKKVLVIGGGDGGVLREIVKHDCVEEAILCDIDEAVVRLSKQFLPKMAAGLTHPKSTVHIGDGF KFLDDYKNTFDVIITDSSDPEGPAESLFQKPYFQLLHDALRDGGVITTQGSENQWLHLPLITKLKKDCKEIFPVA EYAYTTIPTYPSGQIGFMVCCKDASRDVKVPLRRWTPEEEMQKCQYYSADIHKASFVLPNFAKKALQ* |
Coding | >Hirsu2|4293 ATGTCCGAAATCGCACACCCCACGATCAAGGATGGATGGTTCCGGGAGATCTCGGACATGTGGCCCGGCCAGGCC ATGACGCTCAAGGTCGAAAAGGTGCTGCACCATGAGAAGAGCAAATACCAGGATGTCCTCATCTTCAAGTCCACC GACCACGGCACCGTCCTGGTCCTCGACAACGTCATCCAGTGCACCGAGCGCGACGAGTTCTCCTACCAGGAGATG ATCACCCACCTGGCCATGAACTCCCACCCCAACCCCAAGAAGGTCCTCGTCATCGGTGGCGGTGACGGCGGCGTC CTCCGCGAGATTGTCAAGCACGATTGCGTCGAGGAGGCCATCCTCTGCGACATTGACGAGGCCGTCGTTCGCCTT TCGAAGCAGTTCCTGCCCAAGATGGCTGCCGGCCTTACCCACCCCAAGAGCACTGTCCACATCGGCGACGGCTTC AAGTTCCTCGACGACTACAAGAACACCTTCGACGTCATCATCACCGACTCCTCCGACCCCGAGGGCCCTGCCGAG AGCCTCTTCCAGAAGCCTTACTTCCAGCTTCTCCACGATGCCCTTCGTGATGGCGGCGTCATCACGACCCAAGGT TCTGAGAACCAATGGCTTCACCTGCCCCTCATCACCAAGCTCAAGAAGGACTGCAAGGAGATCTTCCCCGTGGCC GAGTACGCCTACACGACCATCCCTACCTATCCATCGGGCCAGATTGGCTTCATGGTGTGCTGCAAAGATGCCAGC CGCGACGTCAAGGTGCCGCTCCGCCGCTGGACCCCCGAGGAAGAGATGCAGAAGTGCCAGTACTACAGTGCCGAT ATCCACAAGGCCAGCTTCGTACTGCCCAACTTTGCCAAGAAGGCTCTTCAATAG |
Transcript | >Hirsu2|4293 ATGTCCGAAATCGCACACCCCACGATCAAGGATGGATGGTTCCGGGAGATCTCGGACATGTGGCCCGGCCAGGCC ATGACGCTCAAGGTCGAAAAGGTGCTGCACCATGAGAAGAGCAAATACCAGGATGTCCTCATCTTCAAGTCCACC GACCACGGCACCGTCCTGGTCCTCGACAACGTCATCCAGTGCACCGAGCGCGACGAGTTCTCCTACCAGGAGATG ATCACCCACCTGGCCATGAACTCCCACCCCAACCCCAAGAAGGTCCTCGTCATCGGTGGCGGTGACGGCGGCGTC CTCCGCGAGATTGTCAAGCACGATTGCGTCGAGGAGGCCATCCTCTGCGACATTGACGAGGCCGTCGTTCGCCTT TCGAAGCAGTTCCTGCCCAAGATGGCTGCCGGCCTTACCCACCCCAAGAGCACTGTCCACATCGGCGACGGCTTC AAGTTCCTCGACGACTACAAGAACACCTTCGACGTCATCATCACCGACTCCTCCGACCCCGAGGGCCCTGCCGAG AGCCTCTTCCAGAAGCCTTACTTCCAGCTTCTCCACGATGCCCTTCGTGATGGCGGCGTCATCACGACCCAAGGT TCTGAGAACCAATGGCTTCACCTGCCCCTCATCACCAAGCTCAAGAAGGACTGCAAGGAGATCTTCCCCGTGGCC GAGTACGCCTACACGACCATCCCTACCTATCCATCGGGCCAGATTGGCTTCATGGTGTGCTGCAAAGATGCCAGC CGCGACGTCAAGGTGCCGCTCCGCCGCTGGACCCCCGAGGAAGAGATGCAGAAGTGCCAGTACTACAGTGCCGAT ATCCACAAGGCCAGCTTCGTACTGCCCAACTTTGCCAAGAAGGCTCTTCAATAG |
Gene | >Hirsu2|4293 ATGTCCGAAATCGCACACCCCACGATCAAGGGTCAGTCAGCTCTCCTGTTTGAATGGCAGATACCCCGCGCTGGA TGGCTGCAACCCCCTCCCCCTCGTCTTTCAGACGGCAGGGCTGGCTCGAGAGCAATTGTATGACTGCGGCATGCC GCTGTTTTACATCAAGTGCATCTGCAGAAAAAGAATAAAAAGCCGGTCATACCACACTGGCTTCGAGCTGCCCGC GCCTTGCGCGCCTCGCCAGCCAGAGGGGAAGAGTTTTCCCTCGTTGAAGCCCGCTGCACCGGAGACGGCCACGAC GATGCCCTCACTCTAGCCAAAAAGGAAAAGAGGAGGGAAAAAAAAGCAGAGGAGCTCAAGCTGCTGACACTCGCG CAGATGGATGGTTCCGGGAGATCTCGGACATGTGGCCCGGTAAGCTTTCCTCTCCTTTTCTCATGATGCCCTACC CCCGACAAGCGCAAGGGCTCATGGCGCCCCGCGAACAGGCCAGGCCATGACGCTCAAGGTCGAAAAGGTGCTGCA CCATGAGAAGAGCAAATACCAGGATGTCCTCATCTTCAAGTCCACCGACCACGGCACCGTCCTGGTCCTCGACAA CGTCATCCAGTGCACCGAGCGCGACGAGTTCTCCTACCAGGAGATGATCACCCACCTGGCCATGAACTCCCACCC CAACCCCAAGAAGGTCCTCGTCATCGGTGGCGGTGACGGCGGCGTCCTCCGCGAGATTGTCAAGCACGATTGCGT CGAGGAGGCCATCCTCTGCGACATTGACGAGGTGGGTCCATCCTTGCCTCCGTCCCCCCGTCTCTCCATTCCCGT TTCCCGTTCTTCGTTCGTGGCACAGGCACATGCCGACACTTCATTTCCCCTGCTCTTGAGTCGCACGCTGCTGAC ATGGCCCTCCCCTTGGCTACCCCTTAACGCAGGCCGTCGTTCGCCTTTCGAAGCAGTTCCTGCCCAAGATGGCTG CCGGCCTTACCCACCCCAAGAGCACTGTCCACATCGGCGACGGCTTCAAGTTCCTCGACGACTACAAGAACACCT TCGACGTCATCATCACCGACTCCTCCGACCCCGAGGGCCCTGCCGAGAGCCTCTTCCAGAAGCCTTACTTCCAGC TTCTCCACGATGCCCTTCGTGATGGCGGCGTCATCACGACCCAAGGTTGTATGTCTCGGTTTTTTCTACGAGGAA AGCAGAGGCATCCCTAGGAACGGCAGTGTGGCGGAACCATTGGGCCTGGCAAGCCGAGCCTATCGGCTGTTGGCA GGTGTCTCTGATGCCCGTCGTACCCTAGGCATTGCCCATGGCCAGTGCCGCTTTCCCCACACTCCTTGCCTCGGT AGTTCCGAGGTGCGCGCGCAGCCAGCCGCGAAGCCATTGGCCCGGCTCTCGCGGTCTGCTCGCCGGTTCCTGTCG TCTCTTAGTCCTGAAAGTGTGTCCTGTCCGAGAATATTTCTTGCTGACGTAGGCCGGCCTTAGCTGAGAACCAAT GGCTTCACCTGCCCCTCATCACCAAGCTCAAGAAGGACTGCAAGGAGATCTTCCCCGTGGCCGAGTACGCCTACA CGACCATCCCTACCTATCCATCGGGCCAGATTGGCTTCATGGTGTGCTGCAAAGATGCCAGCCGCGACGTCAAGG TGCCGCTCCGCCGCTGGACCCCCGAGGAAGAGATGCAGAAGTGCCAGTACTACAGTGCCGATATCCACAAGGCCA GCTTCGTACTGCCCAACTTTGCCAAGAAGGCTCTTCAATAG |