Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4290
Gene name
LocationContig_22:9522..13876
Strand+
Gene length (bp)4354
Transcript length (bp)3999
Coding sequence length (bp)3999
Protein length (aa) 1333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 3.2E-08 202 406
PF05199 GMC_oxred_C GMC oxidoreductase 9.5E-06 594 652

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B5WWZ9|FAO2_LOTJA Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus GN=FAO2 PE=2 SV=1 111 661 4.0E-08

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4290
MVIVRIPVEGRTCGAELVQTPPNLTRRRPRPRGGDVAAQAPALDLDSRSDEQDPLNNKPCHQDAPPSESRLDICH
TCSPAPPGESKSKPSSGRRKGAYPRPFPRISKPVELMRLSYDCVVIGSGYGAGVAASRMARAGESVCLLERGEER
WPGEYPESLGDAAKQFHCSGRPTPGLCGGGFVDSGNPMGMYHLILGQGQSAVVCNGLGGTSLINANVFLEADAST
LAMDVWPPQIRQDPDCLARYYQKVRETLEPEQYPDHWPTLKKAAVFRHQAESLGMSDRLYRVPQTTRFRQGPNSC
GVNMSASTLTGQDAMGINDGSKTTTLVTYLADAWNWGADMFCQCEARHIERVEDARGGYLVYFSWRGRGRDRFRD
GAEGELMWVHARKAVFLGAGAVGTTEILLRSKSMGLGISDCVGQGMSGNGDMLAFGYNADCEVNAVGNPSPCPRN
PVGPTISTAIDCRGEHGFIIQEGAIPQPFSEFLRAVLDLVPGEQVAEGEGLLGRVQAVLSGWKTKLLGPYAGTGV
MERTQVFLIMSRDGGQGTLRLEDGKPVLELPVTEQSDQAKKLNALLARATEMVGGTLVLDPLCAGQGVTVHPLGT
GSTGVTNHAGEVFTGNNTRRTHPGLIVTDGAVVPAALGVNPAATIAALAERAVAEYARENNLTVSEERNDVLDLY
GKPAHGPRSRETDGSRAEADKMRIVERRLRAADQGDALDFTELLYGFVHSGPGVTANDDKAAFGPAYRTAKSRGE
AARLLLSVIVLDACLHGGGIVTGTFVCPTIEGSPFMILRGDMSLLKPDQQAPGTRTLTYSLPMTGINGRRLCLRG
RKVVDSSVALDPRELWRATTTLYVTISEPTPESHIRWKAARSGMALTGGRRRPLAMGIMHIGLGDFLSEVLTLTA
TGKNLLDRARGVAKFVSHFSCEALPAFLTPLAPLQYAAPEDEACGSIRRDTGPTHSHVIEASDGVRTELHVWEPA
PGAVATDEAGVGVETENLLMIPGAAVDHQMFALPTVPVNAVDYFTRAGYRVFVAVHRICKGTTGQGQWTTYDARL
DVRASLEHIRRRHGRVYAVAHCLGALALASGLLDGSIPAQWLEGITCSQVLMHPLWEALNMVKVRLPLDRLYTLL
AGRWFECATSTDDSLVQQALNQLLRLYPQERRELCSSAACHRATLLFGRCWSHGNLNEATHRHLDRLLGGANMTL
LDLLVQMGRRGTLLANGPGYQELATADNVRRLRGLPILLFTGGDNAVLSPLATERSYESLRDVFGVQHCRRRLVP
GYGHLDCWMGRNAWRDVFPLVRREVDRVLRGEAYRFRPPCDGFTPLMEESAAAMAEP*
Coding >Hirsu2|4290
ATGGTCATCGTCAGAATACCCGTCGAGGGGAGGACGTGCGGTGCCGAGCTCGTCCAAACGCCCCCGAATCTCACG
AGGCGACGCCCCCGGCCGCGCGGTGGCGATGTTGCCGCACAAGCTCCCGCTCTCGACTTGGACAGCCGCTCCGAC
GAGCAGGACCCTCTCAACAACAAGCCGTGTCATCAGGACGCGCCGCCGAGCGAGAGCAGACTCGACATCTGCCAC
ACCTGTTCGCCGGCCCCCCCGGGGGAAAGCAAGTCGAAACCGAGCTCCGGCAGACGAAAAGGCGCATACCCGAGA
CCTTTCCCGCGCATCTCAAAACCGGTGGAGCTCATGCGCCTCTCGTACGACTGCGTCGTCATCGGATCCGGCTAT
GGGGCCGGCGTTGCTGCCTCGCGCATGGCACGGGCTGGCGAGTCCGTCTGCTTGCTCGAGCGGGGCGAGGAGAGA
TGGCCCGGCGAGTATCCCGAGAGCCTCGGCGATGCGGCCAAGCAGTTCCATTGCTCGGGTCGGCCCACGCCCGGG
CTTTGCGGCGGCGGCTTCGTTGACAGCGGCAATCCCATGGGCATGTATCATCTGATACTCGGCCAGGGTCAGAGT
GCCGTGGTTTGCAATGGTCTTGGCGGAACAAGCCTGATCAACGCGAATGTCTTTCTCGAAGCGGATGCTAGCACG
CTAGCCATGGACGTCTGGCCTCCGCAGATCCGACAAGACCCGGACTGTCTGGCGAGGTACTACCAGAAGGTTAGG
GAGACGCTCGAACCCGAGCAGTATCCGGACCATTGGCCGACACTGAAGAAGGCGGCCGTGTTTAGGCACCAAGCC
GAGTCGCTTGGTATGAGCGACAGGCTGTACAGGGTTCCGCAGACGACACGCTTCCGCCAGGGGCCCAACAGCTGC
GGCGTCAACATGTCAGCCTCCACGCTGACGGGACAGGATGCCATGGGCATCAACGACGGCTCAAAGACGACGACA
TTGGTCACGTACCTGGCCGACGCCTGGAACTGGGGAGCCGACATGTTCTGCCAGTGTGAGGCCCGGCACATTGAA
AGGGTCGAGGACGCCCGCGGCGGCTATCTCGTTTATTTCAGCTGGCGCGGCCGCGGCCGGGACCGTTTCCGAGAC
GGCGCAGAAGGAGAGCTCATGTGGGTGCATGCGAGAAAAGCCGTCTTCCTCGGCGCCGGTGCCGTCGGGACCACG
GAGATACTGCTCAGGAGCAAGTCTATGGGACTGGGCATCAGCGATTGCGTGGGACAAGGCATGAGCGGTAATGGC
GACATGCTGGCGTTCGGGTACAACGCCGACTGCGAAGTCAACGCCGTCGGAAACCCCAGCCCGTGCCCGAGAAAC
CCGGTCGGACCAACCATCAGCACCGCCATAGACTGCCGGGGAGAGCACGGCTTCATCATTCAAGAGGGCGCCATC
CCGCAGCCCTTCTCGGAATTTTTGCGGGCCGTCCTCGACCTTGTTCCCGGTGAGCAGGTAGCGGAGGGTGAAGGC
CTCCTCGGCCGAGTCCAGGCAGTGCTCAGCGGATGGAAGACTAAGCTGCTTGGCCCGTACGCTGGGACCGGCGTC
ATGGAGAGGACGCAGGTTTTTCTCATCATGTCACGCGACGGTGGCCAGGGGACACTGCGTCTGGAGGATGGCAAG
CCCGTGCTTGAGCTCCCGGTAACCGAGCAGAGCGACCAAGCAAAGAAGCTCAACGCTTTGCTTGCCCGGGCGACG
GAAATGGTAGGGGGTACGCTGGTGCTGGATCCCCTCTGCGCCGGCCAAGGGGTGACGGTCCACCCGCTCGGCACG
GGCTCGACCGGGGTGACGAACCATGCTGGCGAGGTCTTTACAGGGAACAACACTCGTCGCACGCACCCGGGGCTC
ATCGTGACGGACGGCGCCGTTGTGCCGGCCGCACTCGGCGTCAACCCGGCCGCGACGATTGCGGCCCTGGCCGAA
CGAGCGGTGGCCGAGTACGCCCGGGAAAATAACCTCACCGTCAGCGAGGAGCGGAACGACGTCCTCGATCTGTAC
GGGAAGCCAGCGCATGGCCCGAGAAGCCGAGAGACCGACGGGTCGAGAGCTGAGGCTGACAAGATGAGAATCGTC
GAGCGCAGGCTGCGGGCGGCGGATCAGGGCGATGCTCTCGACTTCACCGAGCTCCTGTACGGCTTTGTACACAGC
GGCCCGGGCGTGACGGCAAACGACGACAAAGCCGCATTTGGACCGGCCTACCGCACGGCAAAGAGCCGCGGCGAG
GCGGCCAGGTTGCTTCTGAGTGTCATCGTCTTGGATGCGTGTCTGCATGGCGGGGGCATTGTGACGGGCACCTTT
GTCTGCCCGACAATCGAGGGCTCGCCGTTCATGATCTTGCGGGGCGACATGAGCCTACTCAAGCCTGATCAGCAA
GCGCCAGGAACCAGGACGCTGACGTACAGCCTGCCCATGACTGGCATCAACGGACGGCGACTCTGCCTTCGGGGA
CGCAAGGTGGTCGACTCATCGGTCGCGCTGGATCCACGCGAGCTATGGCGCGCAACGACGACACTATATGTGACC
ATTTCGGAGCCGACGCCCGAGAGCCATATCCGATGGAAGGCTGCTCGGTCGGGGATGGCGCTCACGGGCGGACGT
CGACGGCCGCTGGCGATGGGCATCATGCATATAGGCCTGGGTGACTTCCTGTCCGAGGTGCTCACCCTGACAGCC
ACCGGCAAAAACTTGCTAGACAGGGCGCGGGGGGTGGCCAAGTTCGTATCGCACTTTTCGTGCGAAGCATTGCCG
GCCTTCTTGACACCCCTGGCGCCGCTCCAGTATGCAGCGCCGGAGGACGAGGCCTGCGGTTCTATTCGCCGCGAC
ACCGGGCCCACGCACTCGCACGTCATCGAAGCGAGCGACGGGGTGCGGACGGAGCTGCACGTGTGGGAGCCGGCG
CCCGGCGCCGTGGCGACGGACGAGGCAGGCGTTGGCGTCGAGACGGAGAACCTGCTCATGATACCCGGAGCGGCC
GTGGACCACCAGATGTTCGCGCTGCCGACGGTGCCGGTCAACGCCGTCGACTACTTCACGCGGGCCGGCTACCGC
GTCTTTGTGGCGGTGCACCGCATCTGCAAGGGGACGACGGGCCAGGGGCAGTGGACGACGTACGACGCGCGGCTC
GACGTGCGGGCTAGCCTCGAGCACATCCGGCGGCGGCACGGGCGCGTCTACGCCGTCGCGCACTGCCTCGGGGCG
CTGGCGCTGGCGAGCGGGCTGCTGGACGGCAGCATCCCGGCGCAGTGGCTGGAGGGCATCACCTGCAGCCAGGTC
TTGATGCACCCGCTGTGGGAGGCGCTGAACATGGTCAAGGTCCGATTGCCGCTGGACCGGCTGTACACGCTGCTG
GCGGGCCGCTGGTTCGAGTGCGCGACGTCGACCGACGACAGCCTCGTCCAGCAGGCGCTCAACCAGCTGCTGCGG
CTGTACCCGCAGGAGCGGCGCGAGCTGTGTAGCAGCGCGGCCTGCCACCGCGCCACCCTGCTGTTCGGCCGCTGC
TGGAGCCACGGCAACCTCAACGAGGCGACGCACCGACACCTGGACCGCCTCCTCGGGGGCGCCAACATGACGCTG
CTGGACCTGCTGGTGCAGATGGGCCGCCGCGGCACCCTGCTGGCCAACGGGCCGGGCTACCAGGAGCTGGCGACG
GCCGACAACGTGCGGCGCCTGCGTGGCCTGCCCATCCTGCTGTTCACCGGCGGCGACAACGCGGTGCTGTCGCCG
CTGGCCACCGAGAGGTCGTACGAGAGCCTGCGCGATGTTTTCGGCGTCCAGCACTGTCGCCGTCGCCTCGTCCCG
GGCTACGGACACCTGGACTGTTGGATGGGCCGCAACGCGTGGCGCGATGTGTTTCCCTTGGTGCGCCGCGAGGTC
GACCGCGTCCTCCGTGGCGAGGCGTACCGCTTCCGCCCGCCCTGCGACGGCTTCACGCCGCTGATGGAGGAGAGC
GCCGCGGCTATGGCAGAGCCTTGA
Transcript >Hirsu2|4290
ATGGTCATCGTCAGAATACCCGTCGAGGGGAGGACGTGCGGTGCCGAGCTCGTCCAAACGCCCCCGAATCTCACG
AGGCGACGCCCCCGGCCGCGCGGTGGCGATGTTGCCGCACAAGCTCCCGCTCTCGACTTGGACAGCCGCTCCGAC
GAGCAGGACCCTCTCAACAACAAGCCGTGTCATCAGGACGCGCCGCCGAGCGAGAGCAGACTCGACATCTGCCAC
ACCTGTTCGCCGGCCCCCCCGGGGGAAAGCAAGTCGAAACCGAGCTCCGGCAGACGAAAAGGCGCATACCCGAGA
CCTTTCCCGCGCATCTCAAAACCGGTGGAGCTCATGCGCCTCTCGTACGACTGCGTCGTCATCGGATCCGGCTAT
GGGGCCGGCGTTGCTGCCTCGCGCATGGCACGGGCTGGCGAGTCCGTCTGCTTGCTCGAGCGGGGCGAGGAGAGA
TGGCCCGGCGAGTATCCCGAGAGCCTCGGCGATGCGGCCAAGCAGTTCCATTGCTCGGGTCGGCCCACGCCCGGG
CTTTGCGGCGGCGGCTTCGTTGACAGCGGCAATCCCATGGGCATGTATCATCTGATACTCGGCCAGGGTCAGAGT
GCCGTGGTTTGCAATGGTCTTGGCGGAACAAGCCTGATCAACGCGAATGTCTTTCTCGAAGCGGATGCTAGCACG
CTAGCCATGGACGTCTGGCCTCCGCAGATCCGACAAGACCCGGACTGTCTGGCGAGGTACTACCAGAAGGTTAGG
GAGACGCTCGAACCCGAGCAGTATCCGGACCATTGGCCGACACTGAAGAAGGCGGCCGTGTTTAGGCACCAAGCC
GAGTCGCTTGGTATGAGCGACAGGCTGTACAGGGTTCCGCAGACGACACGCTTCCGCCAGGGGCCCAACAGCTGC
GGCGTCAACATGTCAGCCTCCACGCTGACGGGACAGGATGCCATGGGCATCAACGACGGCTCAAAGACGACGACA
TTGGTCACGTACCTGGCCGACGCCTGGAACTGGGGAGCCGACATGTTCTGCCAGTGTGAGGCCCGGCACATTGAA
AGGGTCGAGGACGCCCGCGGCGGCTATCTCGTTTATTTCAGCTGGCGCGGCCGCGGCCGGGACCGTTTCCGAGAC
GGCGCAGAAGGAGAGCTCATGTGGGTGCATGCGAGAAAAGCCGTCTTCCTCGGCGCCGGTGCCGTCGGGACCACG
GAGATACTGCTCAGGAGCAAGTCTATGGGACTGGGCATCAGCGATTGCGTGGGACAAGGCATGAGCGGTAATGGC
GACATGCTGGCGTTCGGGTACAACGCCGACTGCGAAGTCAACGCCGTCGGAAACCCCAGCCCGTGCCCGAGAAAC
CCGGTCGGACCAACCATCAGCACCGCCATAGACTGCCGGGGAGAGCACGGCTTCATCATTCAAGAGGGCGCCATC
CCGCAGCCCTTCTCGGAATTTTTGCGGGCCGTCCTCGACCTTGTTCCCGGTGAGCAGGTAGCGGAGGGTGAAGGC
CTCCTCGGCCGAGTCCAGGCAGTGCTCAGCGGATGGAAGACTAAGCTGCTTGGCCCGTACGCTGGGACCGGCGTC
ATGGAGAGGACGCAGGTTTTTCTCATCATGTCACGCGACGGTGGCCAGGGGACACTGCGTCTGGAGGATGGCAAG
CCCGTGCTTGAGCTCCCGGTAACCGAGCAGAGCGACCAAGCAAAGAAGCTCAACGCTTTGCTTGCCCGGGCGACG
GAAATGGTAGGGGGTACGCTGGTGCTGGATCCCCTCTGCGCCGGCCAAGGGGTGACGGTCCACCCGCTCGGCACG
GGCTCGACCGGGGTGACGAACCATGCTGGCGAGGTCTTTACAGGGAACAACACTCGTCGCACGCACCCGGGGCTC
ATCGTGACGGACGGCGCCGTTGTGCCGGCCGCACTCGGCGTCAACCCGGCCGCGACGATTGCGGCCCTGGCCGAA
CGAGCGGTGGCCGAGTACGCCCGGGAAAATAACCTCACCGTCAGCGAGGAGCGGAACGACGTCCTCGATCTGTAC
GGGAAGCCAGCGCATGGCCCGAGAAGCCGAGAGACCGACGGGTCGAGAGCTGAGGCTGACAAGATGAGAATCGTC
GAGCGCAGGCTGCGGGCGGCGGATCAGGGCGATGCTCTCGACTTCACCGAGCTCCTGTACGGCTTTGTACACAGC
GGCCCGGGCGTGACGGCAAACGACGACAAAGCCGCATTTGGACCGGCCTACCGCACGGCAAAGAGCCGCGGCGAG
GCGGCCAGGTTGCTTCTGAGTGTCATCGTCTTGGATGCGTGTCTGCATGGCGGGGGCATTGTGACGGGCACCTTT
GTCTGCCCGACAATCGAGGGCTCGCCGTTCATGATCTTGCGGGGCGACATGAGCCTACTCAAGCCTGATCAGCAA
GCGCCAGGAACCAGGACGCTGACGTACAGCCTGCCCATGACTGGCATCAACGGACGGCGACTCTGCCTTCGGGGA
CGCAAGGTGGTCGACTCATCGGTCGCGCTGGATCCACGCGAGCTATGGCGCGCAACGACGACACTATATGTGACC
ATTTCGGAGCCGACGCCCGAGAGCCATATCCGATGGAAGGCTGCTCGGTCGGGGATGGCGCTCACGGGCGGACGT
CGACGGCCGCTGGCGATGGGCATCATGCATATAGGCCTGGGTGACTTCCTGTCCGAGGTGCTCACCCTGACAGCC
ACCGGCAAAAACTTGCTAGACAGGGCGCGGGGGGTGGCCAAGTTCGTATCGCACTTTTCGTGCGAAGCATTGCCG
GCCTTCTTGACACCCCTGGCGCCGCTCCAGTATGCAGCGCCGGAGGACGAGGCCTGCGGTTCTATTCGCCGCGAC
ACCGGGCCCACGCACTCGCACGTCATCGAAGCGAGCGACGGGGTGCGGACGGAGCTGCACGTGTGGGAGCCGGCG
CCCGGCGCCGTGGCGACGGACGAGGCAGGCGTTGGCGTCGAGACGGAGAACCTGCTCATGATACCCGGAGCGGCC
GTGGACCACCAGATGTTCGCGCTGCCGACGGTGCCGGTCAACGCCGTCGACTACTTCACGCGGGCCGGCTACCGC
GTCTTTGTGGCGGTGCACCGCATCTGCAAGGGGACGACGGGCCAGGGGCAGTGGACGACGTACGACGCGCGGCTC
GACGTGCGGGCTAGCCTCGAGCACATCCGGCGGCGGCACGGGCGCGTCTACGCCGTCGCGCACTGCCTCGGGGCG
CTGGCGCTGGCGAGCGGGCTGCTGGACGGCAGCATCCCGGCGCAGTGGCTGGAGGGCATCACCTGCAGCCAGGTC
TTGATGCACCCGCTGTGGGAGGCGCTGAACATGGTCAAGGTCCGATTGCCGCTGGACCGGCTGTACACGCTGCTG
GCGGGCCGCTGGTTCGAGTGCGCGACGTCGACCGACGACAGCCTCGTCCAGCAGGCGCTCAACCAGCTGCTGCGG
CTGTACCCGCAGGAGCGGCGCGAGCTGTGTAGCAGCGCGGCCTGCCACCGCGCCACCCTGCTGTTCGGCCGCTGC
TGGAGCCACGGCAACCTCAACGAGGCGACGCACCGACACCTGGACCGCCTCCTCGGGGGCGCCAACATGACGCTG
CTGGACCTGCTGGTGCAGATGGGCCGCCGCGGCACCCTGCTGGCCAACGGGCCGGGCTACCAGGAGCTGGCGACG
GCCGACAACGTGCGGCGCCTGCGTGGCCTGCCCATCCTGCTGTTCACCGGCGGCGACAACGCGGTGCTGTCGCCG
CTGGCCACCGAGAGGTCGTACGAGAGCCTGCGCGATGTTTTCGGCGTCCAGCACTGTCGCCGTCGCCTCGTCCCG
GGCTACGGACACCTGGACTGTTGGATGGGCCGCAACGCGTGGCGCGATGTGTTTCCCTTGGTGCGCCGCGAGGTC
GACCGCGTCCTCCGTGGCGAGGCGTACCGCTTCCGCCCGCCCTGCGACGGCTTCACGCCGCTGATGGAGGAGAGC
GCCGCGGCTATGGCAGAGCCTTGA
Gene >Hirsu2|4290
ATGGTCATCGTCAGAATACCCGTCGAGGGGAGGACGTGCGGTGCCGAGCTCGTCCAAACGCCCCCGAATCTCACG
AGGCGACGCCCCCGGCCGCGCGGTGGCGATGTTGCCGCACAAGCTCCCGCTCTCGACTTGGACAGCCGCTCCGAC
GAGCAGGACCCTCTCAACAACAAGCCGTGTCATCAGGACGCGCCGCCGAGCGAGAGCAGACTCGACATCTGCCAC
ACCTGTTCGCCGGCCCCCCCGGGGGAAAGCAAGTCGAAACCGAGCTCCGGCAGACGAAAAGGCGCATACCCGAGA
CCTTTCCCGCGCATCTCAAAACCGGTGGAGCTCATGCGCCTCTCGTACGACTGCGTCGTCATCGGATCCGGCTAT
GGGGCCGGCGTTGCTGCCTCGCGCATGGCACGGGCTGGCGAGTCCGTCTGCTTGCTCGAGCGGGGCGAGGAGAGA
TGGCCCGGCGAGTATCCCGAGAGCCTCGGCGATGCGGCCAAGCAGTTCCATTGCTCGGGTCGGCCCACGCCCGGG
CTTTGCGGCGGCGGCTTCGTTGACAGCGGCAATCCCATGGGCATGTATCATCTGATACTCGGCCAGGGTCAGAGT
GCCGTGGTTTGCAATGGTAAGCGGGCACAGAGTTTGCGCCCCTTCTATCCATTGGCCTTTGCTCACCCGCTCCGT
TCGTCAGGTCTTGGCGGAACAAGCCTGATCAACGCGAATGTCTTTCTCGAAGCGGATGCTAGCACGCTAGCCATG
GACGTCTGGCCTCCGCAGATCCGACAAGACCCGGACTGTCTGGCGAGGTGTAAGTGATGCCTGTCAGATCATCGA
TGAGCCGATCCTCGTGTTGACCGACTCCTGTCGTCGGCACTCCTCTCATAGACTACCAGAAGGTTAGGGAGACGC
TCGAACCCGAGCAGTATCCGGACCATTGGCCGACACTGAAGAAGGCGGCCGTGTTTAGGCACCAAGCCGAGTCGC
TTGGTATGAGCGACAGGCTGTACAGGGTTCCGCAGACGACACGCTTCCGCCAGGGGCCCAACAGCTGCGGCGTCA
ACATGTCAGCCTCCACGCTGACGGGACAGGATGCCATGGGCATCAACGACGGCTCAAAGACGACGACATTGGTCA
CGTACCTGGCCGACGCCTGGAACTGGGGAGCCGACATGTTCTGCCAGTGTGAGGCCCGGCACATTGAAAGGGTCG
AGGACGCCCGCGGCGGCTATCTCGTTTATTTCAGCTGGCGCGGCCGCGGCCGGGACCGTTTCCGAGACGGCGCAG
AAGGAGAGCTCATGTGGGTGCATGCGAGAAAAGCCGTCTTCCTCGGCGCCGGTGCCGTCGGGACCACGGAGATAC
TGCTCAGGAGCAAGTCTATGGGACTGGGCATCAGCGATTGCGTGGGACAAGGCATGAGCGGTAATGGCGACATGC
TGGCGTTCGGGTCGGTGTCTGCTTTCCCACACGAGACGTGAAGCCGGCTCACTAGAGCTCTCACAGGTACAACGC
CGACTGCGAAGTCAACGCCGTCGGAAACCCCAGCCCGTGCCCGAGAAACCCGGTCGGACCAACCATCAGCACCGC
CATAGACTGCCGGGGAGAGCACGGCTTCATCATTCAAGAGGGCGCCATCCCGCAGCCCTTCTCGGAATTTTTGCG
GGCCGTCCTCGACCTTGTTCCCGGTGAGCAGGTAGCGGAGGGTGAAGGCCTCCTCGGCCGAGTCCAGGCAGTGCT
CAGCGGATGGAAGACTAAGCTGCTTGGCCCGTACGCTGGGACCGGCGTCATGGAGAGGACGCAGGTTTTTCTCAT
CATGTCACGCGACGGTATGCCCTACCGCGGGGATCCGCCGAGGAAGCAGTCGCTGATACGAAAGTCCAGGTGGCC
AGGGGACACTGCGTCTGGAGGATGGCAAGCCCGTGCTTGAGCTCCCGGTAACCGAGCAGAGCGACCAAGCAAAGA
AGCTCAACGCTTTGCTTGCCCGGGCGACGGAAATGGTAGGGGGTACGCTGGTGCTGGATCCCCTCTGCGCCGGCC
AAGGGGTGACGGTCCACCCGCTCGGGTGAGAGTTCCCTGACCGAGAAGTACAAAGCGGTACGCTGTGCACACAAT
GTTCAAGTCTGACCAGGCCGCCCTCAGCGGAGCAGGAATGTCTCGGGACAGCACGGGCTCGACCGGGGTGACGAA
CCATGCTGGCGAGGTCTTTACAGGGAACAACACTCGTCGCACGCACCCGGGGCTCATCGTGACGGACGGCGCCGT
TGTGCCGGCCGCACTCGGCGTCAACCCGGCCGCGACGATTGCGGCCCTGGCCGAACGAGCGGTGGCCGAGTACGC
CCGGGAAAATAACCTCACCGTCAGCGAGGAGCGGAACGACGTCCTCGATCTGTACGGGAAGCCAGCGCATGGCCC
GAGAAGCCGAGAGACCGACGGGTCGAGAGCTGAGGCTGACAAGATGAGAATCGTCGAGCGCAGGCTGCGGGCGGC
GGATCAGGGCGATGCTCTCGACTTCACCGAGCTCCTGTACGGCTTTGTACACAGCGGCCCGGGCGTGACGGCAAA
CGACGACAAAGCCGCATTTGGACCGGCCTACCGCACGGCAAAGAGCCGCGGCGAGGCGGCCAGGTTGCTTCTGAG
TGTCATCGTCTTGGATGCGTGTCTGCATGGCGGGGGCATTGTGACGGGCACCTTTGTCTGCCCGACAATCGAGGG
CTCGCCGTTCATGATCTTGCGGGGCGACATGAGCCTACTCAAGCCTGATCAGCAAGCGCCAGGAACCAGGACGCT
GACGTACAGCCTGCCCATGACTGGCATCAACGGACGGCGACTCTGCCTTCGGGGACGCAAGGTGGTCGACTCATC
GGTCGCGCTGGATCCACGCGAGCTATGGCGCGCAACGACGACACTATATGTGACCATTTCGGAGCCGACGCCCGA
GAGCCATATCCGATGGAAGGCTGCTCGGTCGGGGATGGCGCTCACGGGCGGACGTCGACGGCCGCTGGCGATGGG
CATCATGCATATAGGCCTGGGTGACTTCCTGTCCGAGGTGCTCACCCTGACAGCCACCGGCAAAAACTTGCTAGA
CAGGGCGCGGGGGGTGGCCAAGTTCGTATCGCACTTTTCGTGCGAAGCATTGCCGGCCTTCTTGACACCCCTGGC
GCCGCTCCAGTATGCAGCGCCGGAGGACGAGGCCTGCGGTTCTATTCGCCGCGACACCGGGCCCACGCACTCGCA
CGTCATCGAAGCGAGCGACGGGGTGCGGACGGAGCTGCACGTGTGGGAGCCGGCGCCCGGCGCCGTGGCGACGGA
CGAGGCAGGCGTTGGCGTCGAGACGGAGAACCTGCTCATGATACCCGGAGCGGCCGTGGACCACCAGATGTTCGC
GCTGCCGACGGTGCCGGTCAACGCCGTCGACTACTTCACGCGGGCCGGCTACCGCGTCTTTGTGGCGGTGCACCG
CATCTGCAAGGGGACGACGGGCCAGGGGCAGTGGACGACGTACGACGCGCGGCTCGACGTGCGGGCTAGCCTCGA
GCACATCCGGCGGCGGCACGGGCGCGTCTACGCCGTCGCGCACTGCCTCGGGGCGCTGGCGCTGGCGAGCGGGCT
GCTGGACGGCAGCATCCCGGCGCAGTGGCTGGAGGGCATCACCTGCAGCCAGGTCTTGATGCACCCGCTGTGGGA
GGCGCTGAACATGGTCAAGGTCCGATTGCCGCTGGACCGGCTGTACACGCTGCTGGCGGGCCGCTGGTTCGAGTG
CGCGACGTCGACCGACGACAGCCTCGTCCAGCAGGCGCTCAACCAGCTGCTGCGGCTGTACCCGCAGGAGCGGCG
CGAGCTGTGTAGCAGCGCGGCCTGCCACCGCGCCACCCTGCTGTTCGGCCGCTGCTGGAGCCACGGCAACCTCAA
CGAGGCGACGCACCGACACCTGGACCGCCTCCTCGGGGGCGCCAACATGACGCTGCTGGACCTGCTGGTGCAGAT
GGGCCGCCGCGGCACCCTGCTGGCCAACGGGCCGGGCTACCAGGAGCTGGCGACGGCCGACAACGTGCGGCGCCT
GCGTGGCCTGCCCATCCTGCTGTTCACCGGCGGCGACAACGCGGTGCTGTCGCCGCTGGCCACCGAGAGGTCGTA
CGAGAGCCTGCGCGATGTTTTCGGCGTCCAGCACTGTCGCCGTCGCCTCGTCCCGGGCTACGGACACCTGGACTG
TTGGATGGGCCGCAACGCGTGGCGCGATGTGTTTCCCTTGGTGCGCCGCGAGGTCGACCGCGTCCTCCGTGGCGA
GGCGTACCGCTTCCGCCCGCCCTGCGACGGCTTCACGCCGCTGATGGAGGAGAGCGCCGCGGCTATGGCAGAGCC
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail