Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4280
Gene name
LocationContig_2197:1595..2309
Strand+
Gene length (bp)714
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04109 APG9 Autophagy protein Apg9 2.0E-70 1 197

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S4D7|ATG9_NEUCR Autophagy-related protein 9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-7 PE=3 SV=1 1 197 9.0E-75
sp|Q875A7|ATG9_PODAS Autophagy-related protein 9 OS=Podospora anserina GN=ATG9 PE=3 SV=1 1 197 2.0E-73
sp|A1CU77|ATG9_ASPCL Autophagy-related protein 9 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg9 PE=3 SV=1 1 195 2.0E-72
sp|A1DNW0|ATG9_NEOFI Autophagy-related protein 9 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg9 PE=3 SV=1 1 195 8.0E-72
sp|Q4WLT9|ATG9_ASPFU Autophagy-related protein 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg9 PE=3 SV=1 1 195 8.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S4D7|ATG9_NEUCR Autophagy-related protein 9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-7 PE=3 SV=1 1 197 9.0E-75
sp|Q875A7|ATG9_PODAS Autophagy-related protein 9 OS=Podospora anserina GN=ATG9 PE=3 SV=1 1 197 2.0E-73
sp|A1CU77|ATG9_ASPCL Autophagy-related protein 9 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg9 PE=3 SV=1 1 195 2.0E-72
sp|A1DNW0|ATG9_NEOFI Autophagy-related protein 9 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg9 PE=3 SV=1 1 195 8.0E-72
sp|Q4WLT9|ATG9_ASPFU Autophagy-related protein 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg9 PE=3 SV=1 1 195 8.0E-72
sp|A7KAM0|ATG9_PENRW Autophagy-related protein 9 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg9 PE=3 SV=1 1 195 1.0E-71
sp|A2QLJ9|ATG9_ASPNC Autophagy-related protein 9 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg9 PE=3 SV=1 1 195 4.0E-70
sp|Q2UUT6|ATG9_ASPOR Autophagy-related protein 9 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg9 PE=3 SV=1 1 195 6.0E-70
sp|Q1E6Q3|ATG9_COCIM Autophagy-related protein 9 OS=Coccidioides immitis (strain RS) GN=ATG9 PE=3 SV=1 1 195 8.0E-68
sp|Q51WZ9|ATG9_MAGO7 Autophagy-related protein 9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG9 PE=3 SV=1 5 195 2.0E-67
sp|Q6C2F5|ATG9_YARLI Autophagy-related protein 9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG9 PE=3 SV=1 1 195 2.0E-60
sp|Q6TGJ4|ATG9_CRYGA Autophagy-related protein 9 OS=Cryptococcus gattii GN=ATG9 PE=3 SV=1 1 196 1.0E-59
sp|A7ERK1|ATG9_SCLS1 Autophagy-related protein 9 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg9 PE=3 SV=2 1 195 4.0E-59
sp|A7TR50|ATG9_VANPO Autophagy-related protein 9 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG9 PE=3 SV=1 1 192 5.0E-58
sp|Q6FQT7|ATG9_CANGA Autophagy-related protein 9 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG9 PE=3 SV=1 1 195 8.0E-58
sp|Q75A48|ATG9_ASHGO Autophagy-related protein 9 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG9 PE=3 SV=1 1 195 3.0E-57
sp|Q12142|ATG9_YEAST Autophagy-related protein 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG9 PE=1 SV=1 1 195 3.0E-55
sp|A6ZXH8|ATG9_YEAS7 Autophagy-related protein 9 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG9 PE=3 SV=1 1 195 3.0E-55
sp|Q6CT08|ATG9_KLULA Autophagy-related protein 9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG9 PE=3 SV=1 1 198 2.0E-53
sp|O74312|ATG9_SCHPO Autophagy-related protein 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg9 PE=1 SV=1 2 195 5.0E-53
sp|Q4P683|ATG9_USTMA Autophagy-related protein 9 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG9 PE=3 SV=1 1 195 6.0E-53
sp|P0CM40|ATG9_CRYNJ Autophagy-related protein 9 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG9 PE=3 SV=1 1 196 3.0E-50
sp|P0CM41|ATG9_CRYNB Autophagy-related protein 9 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG9 PE=3 SV=1 1 196 3.0E-50
sp|Q876N4|ATG9_PICPA Autophagy-related protein 9 OS=Komagataella pastoris GN=ATG9 PE=3 SV=1 1 195 2.0E-49
sp|Q0UYL2|ATG9_PHANO Autophagy-related protein 9 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG9 PE=3 SV=1 3 197 3.0E-47
sp|Q5B6U6|ATG9_EMENI Autophagy-related protein 9 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg9 PE=3 SV=1 37 195 1.0E-45
sp|A7KAI7|ATG9_PICAN Autophagy-related protein 9 OS=Pichia angusta GN=ATG9 PE=3 SV=1 1 195 7.0E-45
sp|A5DEX5|ATG9_PICGU Autophagy-related protein 9 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG9 PE=3 SV=2 1 186 7.0E-42
sp|Q5ANC9|ATG9_CANAL Autophagy-related protein 9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG9 PE=3 SV=1 1 178 4.0E-39
sp|Q6BW58|ATG9_DEBHA Autophagy-related protein 9 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG9 PE=3 SV=2 1 177 9.0E-39
sp|A3LZS3|ATG9_PICST Autophagy-related protein 9 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG9 PE=3 SV=3 1 177 8.0E-36
sp|Q54NA3|ATG9_DICDI Autophagy-related protein 9 OS=Dictyostelium discoideum GN=atg9 PE=2 SV=1 1 191 3.0E-32
sp|Q8RUS5|ATG9_ARATH Autophagy-related protein 9 OS=Arabidopsis thaliana GN=ATG9 PE=2 SV=1 1 191 8.0E-29
sp|Q68FE2|ATG9A_MOUSE Autophagy-related protein 9A OS=Mus musculus GN=Atg9a PE=1 SV=1 14 195 3.0E-18
sp|Q3T904|ATG9A_BOVIN Autophagy-related protein 9A OS=Bos taurus GN=ATG9A PE=2 SV=1 14 195 9.0E-18
sp|Q7Z3C6|ATG9A_HUMAN Autophagy-related protein 9A OS=Homo sapiens GN=ATG9A PE=1 SV=3 14 195 2.0E-17
sp|Q5FWU3|ATG9A_RAT Autophagy-related protein 9A OS=Rattus norvegicus GN=Atg9a PE=1 SV=1 14 195 2.0E-17
sp|Q5RCS0|ATG9A_PONAB Autophagy-related protein 9A OS=Pongo abelii GN=ATG9A PE=2 SV=1 14 195 2.0E-17
sp|Q6EBV9|ATG9B_MOUSE Autophagy-related protein 9B OS=Mus musculus GN=Atg9b PE=2 SV=2 19 185 4.0E-11
sp|Q674R7|ATG9B_HUMAN Autophagy-related protein 9B OS=Homo sapiens GN=ATG9B PE=2 SV=1 24 185 3.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 131 148 17
3 163 182 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4280
MEWYLHYAILDMAFNEFGQVRQDFLRADRRRLLSQKLKQRLYFAGLLNFVFAPVVLAYVVVVYFFTYYNEYQKDP
KLAAARKYSVLAEWKFREFNELPHIFYERLHMSLPFATRYIDQFPKRMTDDIARSIAFMSGAITAVLAVGTVLDS
ELFLGFEITKDRTVLFYLGLFGGVWAMTRGMVSEETSVFNPEYALHNFRG*
Coding >Hirsu2|4280
ATGGAGTGGTACCTTCACTATGCCATCCTCGACATGGCGTTTAACGAGTTTGGCCAGGTGCGGCAAGATTTCCTG
CGGGCCGACCGAAGAAGACTACTCAGTCAAAAGCTCAAACAGCGACTCTACTTTGCGGGGCTGTTGAATTTCGTT
TTTGCCCCGGTGGTGTTAGCGTATGTGGTGGTCGTGTACTTCTTCACGTATTATAATGAATACCAGAAAGACCCG
AAACTAGCAGCGGCCCGCAAGTACAGCGTACTGGCGGAGTGGAAGTTCCGAGAGTTCAACGAGCTGCCGCACATC
TTCTACGAGAGATTACACATGTCACTCCCGTTTGCGACACGCTACATCGATCAGTTTCCAAAGCGAATGACGGAT
GACATCGCCCGGAGCATCGCGTTTATGTCTGGCGCGATCACTGCTGTCCTGGCAGTTGGCACGGTCCTGGATTCG
GAATTGTTTCTCGGGTTTGAGATCACAAAAGACCGGACGGTGCTCTTCTACCTAGGACTGTTTGGAGGCGTCTGG
GCTATGACGCGTGGAATGGTGTCCGAGGAGACGAGCGTCTTCAACCCCGAATACGCCCTTCATAATTTTCGAGGT
TAA
Transcript >Hirsu2|4280
ATGGAGTGGTACCTTCACTATGCCATCCTCGACATGGCGTTTAACGAGTTTGGCCAGGTGCGGCAAGATTTCCTG
CGGGCCGACCGAAGAAGACTACTCAGTCAAAAGCTCAAACAGCGACTCTACTTTGCGGGGCTGTTGAATTTCGTT
TTTGCCCCGGTGGTGTTAGCGTATGTGGTGGTCGTGTACTTCTTCACGTATTATAATGAATACCAGAAAGACCCG
AAACTAGCAGCGGCCCGCAAGTACAGCGTACTGGCGGAGTGGAAGTTCCGAGAGTTCAACGAGCTGCCGCACATC
TTCTACGAGAGATTACACATGTCACTCCCGTTTGCGACACGCTACATCGATCAGTTTCCAAAGCGAATGACGGAT
GACATCGCCCGGAGCATCGCGTTTATGTCTGGCGCGATCACTGCTGTCCTGGCAGTTGGCACGGTCCTGGATTCG
GAATTGTTTCTCGGGTTTGAGATCACAAAAGACCGGACGGTGCTCTTCTACCTAGGACTGTTTGGAGGCGTCTGG
GCTATGACGCGTGGAATGGTGTCCGAGGAGACGAGCGTCTTCAACCCCGAATACGCCCTTCATAATTTTCGAGGT
TAA
Gene >Hirsu2|4280
ATGGAGTGGTACCTTCACTATGCCATCCTCGACATGGCGTTTAACGAGTTTGGCCAGGTGCGGCAAGATTTCCTG
CGGGCCGACCGAAGAAGACTACTCAGTCAAAAGCTCAAACAGCGACTCTACTTTGCGGGGCTGTTGAATTTCGTT
TTTGCCCCGGTGGTGTTAGCGTATGTGGTGGTCGTGTACTTCTTCACGTATTATAATGTGAGCCCTTCTCACGAA
AACCCTTACGATGAGCAACGGAAGCTAATTGATCTGTTAGGAATACCAGAAAGACCCGAAACTAGCAGCGGCCCG
CAAGTACAGCGTACTGGCGGAGTGGAAGTTCCGAGAGTTCAACGAGCTGCCGCACATCTTCTACGAGAGATTACA
CATGTCACTCCCGTTTGCGACACGCTACATCGATCAGTTTCCAAAGCGAATGACGGATGACATCGCCCGGAGCAT
CGCGTTTATGTCTGGCGCGATCACTGCTGTCCTGGCAGTTGGCACGGTCCTGGATTCGGAATTGTTTCTCGGGTT
TGAGATCACAAAAGACCGGACGGTGCTCTTCTACCTAGGACTGTTTGGAGGCGTCTGGGCTATGACGCGTGGAAT
GGTGTCCGAGGAGACGAGCGTCTTCAACCCCGAATACGCCCTTCATAATGTGATTGAATATACGCACTACATGCC
GAACCATTGGCAGGGGCGTCTGCATAGTTTCGAGGTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail