Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4272
Gene name
LocationContig_2192:567..1636
Strand+
Gene length (bp)1069
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02602 HEM4 Uroporphyrinogen-III synthase HemD 2.4E-31 44 323

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87214|HEM4_SCHPO Uroporphyrinogen-III synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ups1 PE=3 SV=1 15 326 2.0E-27
sp|P06174|HEM4_YEAST Uroporphyrinogen-III synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM4 PE=1 SV=2 12 331 2.0E-20
sp|P10746|HEM4_HUMAN Uroporphyrinogen-III synthase OS=Homo sapiens GN=UROS PE=1 SV=1 79 329 1.0E-08

GO

GO Term Description Terminal node
GO:0033014 tetrapyrrole biosynthetic process Yes
GO:0004852 uroporphyrinogen-III synthase activity Yes
GO:0016835 carbon-oxygen lyase activity No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0016829 lyase activity No
GO:0016836 hydro-lyase activity No
GO:0008152 metabolic process No
GO:0033013 tetrapyrrole metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0003824 catalytic activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4272
MALSGSREPNVVPVLLLKTRSSPHDPYEDLFLSSDAAGGPRFAPRFVPVLSHRLEAKGTARLATLLQHRQIGPAA
DSAFGGLILTSQRAVEALAKIVADGKDCDLGAPSSIDSPCTPSKPRCVCRPCDHNWPHLQDVPVYSVGPATARAL
AAVRLRVPLQVFGQHCGNGEALSHFILGHYAKWYSHRPTRPPLLFLVGEQRRDVIPRTLMDTARPVHERITVDEE
VVYGTAVMESFPNDFADALRKTKDAPCRWVVVFSPTGCDSMLCSLGILDPTTGCAESGWGDGTTFIATIGPTTKA
YMAKTFNFEPDVCANTPTPSGVLQAIQEHMRWPPRT*
Coding >Hirsu2|4272
ATGGCGCTGTCCGGAAGCCGCGAGCCAAACGTCGTTCCCGTCCTACTGCTCAAGACGCGGTCCTCCCCGCACGAT
CCTTATGAAGACCTCTTCCTTTCCTCTGACGCTGCCGGCGGACCTCGCTTCGCTCCGCGTTTTGTGCCGGTGCTC
TCCCACCGCCTCGAGGCTAAAGGCACGGCAAGACTCGCCACCTTGCTACAGCACCGTCAAATCGGCCCGGCCGCT
GACAGCGCCTTTGGAGGCCTCATTCTCACGTCGCAGCGGGCCGTCGAGGCATTGGCCAAGATAGTGGCGGACGGG
AAAGATTGTGACTTGGGCGCGCCATCATCAATCGACTCGCCTTGTACTCCCTCCAAGCCACGTTGTGTTTGCCGT
CCGTGCGACCACAACTGGCCACATCTTCAGGACGTACCCGTCTATAGCGTCGGCCCTGCCACAGCGCGCGCGCTC
GCAGCCGTGCGGCTCCGAGTGCCGCTGCAAGTCTTCGGCCAGCACTGCGGTAATGGTGAGGCGCTCAGCCACTTC
ATTCTCGGCCATTACGCGAAGTGGTATAGCCATCGCCCAACGCGCCCGCCCTTATTGTTCCTCGTCGGCGAACAA
CGCAGAGATGTCATCCCCCGCACCCTCATGGACACTGCTCGTCCTGTCCACGAGCGTATCACAGTCGATGAGGAG
GTTGTCTACGGTACTGCTGTCATGGAATCCTTCCCGAACGACTTTGCCGACGCCCTTCGCAAGACCAAAGACGCT
CCTTGTCGGTGGGTCGTCGTCTTCTCTCCAACTGGATGCGACAGCATGCTCTGTAGTCTTGGCATTCTGGACCCC
ACCACAGGCTGTGCTGAATCTGGCTGGGGGGATGGCACGACATTCATAGCCACTATTGGCCCAACGACCAAAGCT
TACATGGCCAAGACGTTCAACTTCGAGCCCGATGTTTGCGCCAACACGCCGACGCCGTCAGGGGTTCTTCAAGCC
ATCCAAGAGCATATGCGTTGGCCTCCGAGAACTTAG
Transcript >Hirsu2|4272
ATGGCGCTGTCCGGAAGCCGCGAGCCAAACGTCGTTCCCGTCCTACTGCTCAAGACGCGGTCCTCCCCGCACGAT
CCTTATGAAGACCTCTTCCTTTCCTCTGACGCTGCCGGCGGACCTCGCTTCGCTCCGCGTTTTGTGCCGGTGCTC
TCCCACCGCCTCGAGGCTAAAGGCACGGCAAGACTCGCCACCTTGCTACAGCACCGTCAAATCGGCCCGGCCGCT
GACAGCGCCTTTGGAGGCCTCATTCTCACGTCGCAGCGGGCCGTCGAGGCATTGGCCAAGATAGTGGCGGACGGG
AAAGATTGTGACTTGGGCGCGCCATCATCAATCGACTCGCCTTGTACTCCCTCCAAGCCACGTTGTGTTTGCCGT
CCGTGCGACCACAACTGGCCACATCTTCAGGACGTACCCGTCTATAGCGTCGGCCCTGCCACAGCGCGCGCGCTC
GCAGCCGTGCGGCTCCGAGTGCCGCTGCAAGTCTTCGGCCAGCACTGCGGTAATGGTGAGGCGCTCAGCCACTTC
ATTCTCGGCCATTACGCGAAGTGGTATAGCCATCGCCCAACGCGCCCGCCCTTATTGTTCCTCGTCGGCGAACAA
CGCAGAGATGTCATCCCCCGCACCCTCATGGACACTGCTCGTCCTGTCCACGAGCGTATCACAGTCGATGAGGAG
GTTGTCTACGGTACTGCTGTCATGGAATCCTTCCCGAACGACTTTGCCGACGCCCTTCGCAAGACCAAAGACGCT
CCTTGTCGGTGGGTCGTCGTCTTCTCTCCAACTGGATGCGACAGCATGCTCTGTAGTCTTGGCATTCTGGACCCC
ACCACAGGCTGTGCTGAATCTGGCTGGGGGGATGGCACGACATTCATAGCCACTATTGGCCCAACGACCAAAGCT
TACATGGCCAAGACGTTCAACTTCGAGCCCGATGTTTGCGCCAACACGCCGACGCCGTCAGGGGTTCTTCAAGCC
ATCCAAGAGCATATGCGTTGGCCTCCGAGAACTTAG
Gene >Hirsu2|4272
ATGGCGCTGTCCGGAAGCCGCGAGCCAAACGTCGTTCCCGTCCTACTGCTCAAGACGCGGTCCTCCCCGCACGAT
CCTTATGAAGACCTCTTCCTTTCCTCTGACGCTGCCGGCGGACCTCGCTTCGCTCCGCGTTTTGTGCCGGTGCTC
TCCCACCGCCTCGAGGCTAAAGGCACGGCAAGACTCGCCACCTTGCTACAGCACCGTCAAATCGGCCCGGCCGCT
GACAGCGCCTTTGGAGGCCTCATTCTCACGTCGCAGCGGGCCGTCGAGGCATTGGCCAAGATAGTGGCGGACGGG
AAAGATTGTGACTTGGGCGCGCCATCATCAATCGACTCGCCTTGTACTCCCTCCAAGCCACGTTGTGTTTGCCGT
CCGTGTGCGCGGCCTGGCAGGCGGCACGCCGAGCGAGTTCTGCTGACCCAATATCTGCCCAGGCGACCACAACTG
GCCACATCTTCAGGACGTACCCGTCTATAGCGTCGGCCCTGCCACAGCGCGCGCGCTCGCAGCCGTGCGGCTCCG
AGTGCCGCTGCAAGTCTTCGGCCAGCACTGCGGTAATGGTGAGGCGCTCAGCCACTTCATTCTCGGCCATTACGC
GAAGTGGTATAGCCATCGCCCAACGCGCCCGCCCTTATTGTTCCTCGTCGGCGAACAACGCAGAGATGTCATCCC
CCGCACCCTCATGGACACTGCTCGTCCTGTCCACGAGCGTATCACAGTCGATGAGGAGGTTGTCTACGGTACTGC
TGTCATGGAATCCTTCCCGAACGACTTTGCCGACGCCCTTCGCAAGACCAAAGACGCTCCTTGTCGGTGGGTCGT
CGTCTTCTCTCCAACTGGATGCGACAGCATGCTCTGTAGTCTTGGCATTCTGGACCCCACCACAGGCTGTGCTGA
ATCTGGCTGGGGGGATGGCACGACATTCATAGCCACTATTGGCCCAACGACCAAAGCTTACATGGCCAAGACGTT
CAACTTCGAGCCCGATGTTTGCGCCAACACGCCGACGCCGTCAGGGGTTCTTCAAGCCATCCAAGAGCATATGCG
TTGGCCTCCGAGAACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail