Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|427
Gene name
LocationContig_1086:7582..8419
Strand+
Gene length (bp)837
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.1E-15 64 259
PF07714 Pkinase_Tyr Protein tyrosine kinase 5.8E-14 62 260

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FJI4|LK111_ARATH Putative L-type lectin-domain containing receptor kinase I.11 OS=Arabidopsis thaliana GN=LECRK111 PE=3 SV=1 79 226 4.0E-09
sp|Q9SI06|Y5573_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2 64 211 1.0E-08
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 61 219 5.0E-08
sp|Q9M3D8|LRK13_ARATH L-type lectin-domain containing receptor kinase I.3 OS=Arabidopsis thaliana GN=LECRK13 PE=1 SV=1 44 277 1.0E-07
sp|Q7TXA9|PKNK_MYCBO Serine/threonine-protein kinase PknK OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknK PE=3 SV=1 104 241 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FJI4|LK111_ARATH Putative L-type lectin-domain containing receptor kinase I.11 OS=Arabidopsis thaliana GN=LECRK111 PE=3 SV=1 79 226 4.0E-09
sp|Q9SI06|Y5573_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2 64 211 1.0E-08
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 61 219 5.0E-08
sp|Q9M3D8|LRK13_ARATH L-type lectin-domain containing receptor kinase I.3 OS=Arabidopsis thaliana GN=LECRK13 PE=1 SV=1 44 277 1.0E-07
sp|Q7TXA9|PKNK_MYCBO Serine/threonine-protein kinase PknK OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknK PE=3 SV=1 104 241 1.0E-07
sp|Q9LIG2|RLK6_ARATH Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1 33 211 2.0E-07
sp|Q06187|BTK_HUMAN Tyrosine-protein kinase BTK OS=Homo sapiens GN=BTK PE=1 SV=3 78 266 3.0E-07
sp|Q13546|RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens GN=RIPK1 PE=1 SV=3 51 161 3.0E-07
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 62 253 5.0E-07
sp|P35991|BTK_MOUSE Tyrosine-protein kinase BTK OS=Mus musculus GN=Btk PE=1 SV=4 78 266 5.0E-07
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 62 253 6.0E-07
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 62 253 7.0E-07
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 57 253 2.0E-06
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 62 253 2.0E-06
sp|C0LGL4|Y2289_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g28960 OS=Arabidopsis thaliana GN=At2g28960 PE=2 SV=1 64 211 2.0E-06
sp|Q07014|LYN_RAT Tyrosine-protein kinase Lyn OS=Rattus norvegicus GN=Lyn PE=1 SV=3 28 260 2.0E-06
sp|A8R7E6|CERK1_ARATH Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana GN=CERK1 PE=1 SV=1 57 222 2.0E-06
sp|P25911|LYN_MOUSE Tyrosine-protein kinase Lyn OS=Mus musculus GN=Lyn PE=1 SV=4 28 260 3.0E-06
sp|O65238|Y5537_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370 OS=Arabidopsis thaliana GN=At5g35370 PE=2 SV=2 79 213 3.0E-06
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 57 253 3.0E-06
sp|C0LGG3|Y5182_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1 33 211 4.0E-06
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 63 213 4.0E-06
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 63 213 4.0E-06
sp|P07948|LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens GN=LYN PE=1 SV=3 28 260 4.0E-06
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 35 243 5.0E-06
sp|Q9FZB8|Y5181_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51810 OS=Arabidopsis thaliana GN=At1g51810 PE=2 SV=1 64 236 5.0E-06
sp|Q1RMT8|IRAK4_BOVIN Interleukin-1 receptor-associated kinase 4 OS=Bos taurus GN=IRAK4 PE=2 SV=1 79 213 5.0E-06
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 61 253 6.0E-06
sp|Q54RB7|SHKA_DICDI Dual specificity protein kinase shkA OS=Dictyostelium discoideum GN=shkA PE=2 SV=1 119 272 6.0E-06
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 96 277 7.0E-06
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 102 219 7.0E-06
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 61 240 8.0E-06
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 61 240 8.0E-06
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 61 240 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|427
MSNMSTHEYVTADNRHVTEIHFYPYFPPEVQVKRVLDTGAGAWIGETDDTTVYRYPKIPGEHIERLEAERKLLEI
VGAHERIIGLKGFTDTGLYLERAANGDVLQYMIVLEQPVSAKQRLTWCREAAEAVAWIHSRCVLDCDINPGNLLL
DDHFHIKLADFQRKHLSEEGESLVGGWSSEPARYKYPREDIDDANTKTDMFALGSTIYFIINGHNAYPDIPEKDR
NNAEKVEARFTSPQFPQDEHVCSAITRKCWQQDMEYESADEIVRDLEYLERES*
Coding >Hirsu2|427
ATGTCAAACATGTCAACCCACGAGTACGTGACTGCGGACAACAGGCACGTGACTGAGATTCATTTCTACCCATAC
TTCCCCCCCGAGGTACAAGTCAAGAGAGTCCTTGACACGGGAGCTGGTGCATGGATCGGAGAAACAGATGACACA
ACCGTCTACAGATACCCGAAAATTCCGGGCGAGCATATAGAACGGCTCGAAGCGGAGAGGAAGCTCCTCGAGATT
GTCGGGGCTCACGAGCGCATCATTGGCCTCAAGGGCTTCACAGACACGGGCCTTTACCTTGAACGTGCGGCGAAC
GGGGATGTACTCCAGTACATGATCGTGCTGGAACAACCTGTCTCGGCCAAGCAGCGGCTGACCTGGTGCCGAGAA
GCTGCCGAGGCAGTCGCCTGGATCCATTCCCGGTGCGTTCTGGACTGCGACATTAACCCCGGGAATCTACTGCTC
GATGACCACTTCCACATCAAGCTTGCCGACTTCCAGAGGAAGCACCTGTCGGAGGAGGGCGAGTCACTCGTTGGC
GGCTGGAGCAGCGAACCGGCCAGGTACAAGTATCCTCGAGAGGATATCGACGATGCAAATACCAAGACGGATATG
TTTGCACTGGGCTCCACCATCTACTTCATCATCAACGGACATAATGCGTACCCTGATATCCCAGAGAAGGACCGG
AACAATGCCGAAAAGGTGGAGGCCAGGTTCACCAGCCCCCAGTTTCCTCAAGATGAACATGTCTGCAGTGCCATC
ACCAGGAAGTGCTGGCAGCAGGACATGGAATATGAATCTGCCGACGAAATTGTCCGAGATTTGGAATATCTTGAG
AGGGAGTCTTGA
Transcript >Hirsu2|427
ATGTCAAACATGTCAACCCACGAGTACGTGACTGCGGACAACAGGCACGTGACTGAGATTCATTTCTACCCATAC
TTCCCCCCCGAGGTACAAGTCAAGAGAGTCCTTGACACGGGAGCTGGTGCATGGATCGGAGAAACAGATGACACA
ACCGTCTACAGATACCCGAAAATTCCGGGCGAGCATATAGAACGGCTCGAAGCGGAGAGGAAGCTCCTCGAGATT
GTCGGGGCTCACGAGCGCATCATTGGCCTCAAGGGCTTCACAGACACGGGCCTTTACCTTGAACGTGCGGCGAAC
GGGGATGTACTCCAGTACATGATCGTGCTGGAACAACCTGTCTCGGCCAAGCAGCGGCTGACCTGGTGCCGAGAA
GCTGCCGAGGCAGTCGCCTGGATCCATTCCCGGTGCGTTCTGGACTGCGACATTAACCCCGGGAATCTACTGCTC
GATGACCACTTCCACATCAAGCTTGCCGACTTCCAGAGGAAGCACCTGTCGGAGGAGGGCGAGTCACTCGTTGGC
GGCTGGAGCAGCGAACCGGCCAGGTACAAGTATCCTCGAGAGGATATCGACGATGCAAATACCAAGACGGATATG
TTTGCACTGGGCTCCACCATCTACTTCATCATCAACGGACATAATGCGTACCCTGATATCCCAGAGAAGGACCGG
AACAATGCCGAAAAGGTGGAGGCCAGGTTCACCAGCCCCCAGTTTCCTCAAGATGAACATGTCTGCAGTGCCATC
ACCAGGAAGTGCTGGCAGCAGGACATGGAATATGAATCTGCCGACGAAATTGTCCGAGATTTGGAATATCTTGAG
AGGGAGTCTTGA
Gene >Hirsu2|427
ATGTCAAACATGTCAACCCACGAGTACGTGACTGCGGACAACAGGCACGTGACTGAGATTCATTTCTACCCATAC
TTCCCCCCCGAGGTACAAGTCAAGAGAGTCCTTGACACGGGAGCTGGTGCATGGATCGGAGAAACAGATGACACA
ACCGTCTACAGATACCCGAAAATTCCGGGCGAGCATATAGAACGGCTCGAAGCGGAGAGGAAGCTCCTCGAGATT
GTCGGGGCTCACGAGCGCATCATTGGCCTCAAGGGCTTCACAGACACGGGCCTTTACCTTGAACGTGCGGCGAAC
GGGGATGTACTCCAGTACATGATCGTGCTGGAACAACCTGTCTCGGCCAAGCAGCGGCTGACCTGGTGCCGAGAA
GCTGCCGAGGCAGTCGCCTGGATCCATTCCCGGTGCGTTCTGGACTGCGACATTAACCCCGGGAATCTACTGCTC
GATGACCACTTCCACATCAAGCTTGCCGACTTCCAGAGGAAGCACCTGTCGGAGGAGGGCGAGTCACTCGTTGGC
GGCTGGAGCAGCGAACCGGCCAGGTACAAGTATCCTCGAGAGGATATCGACGATGCAAATACCAAGACGGATATG
TTTGCACTGGGCTCCACCATCTACTTCATCATCAACGGACATAATGCGTACCCTGATATCCCAGAGAAGGACCGG
AACAATGCCGAAAAGGTGGAGGCCAGGTTCACCAGCCCCCAGTTTCCTCAAGATGAACATGTCTGCAGTGCCATC
ACCAGGAAGTGCTGGCAGCAGGACATGGAATATGAATCTGCCGACGAAATTGTCCGAGATTTGGAATATCTTGAG
AGGGAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail