Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4269
Gene name
LocationContig_2190:350..1650
Strand-
Gene length (bp)1300
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10361 DUF2434 Protein of unknown function (DUF2434) 6.3E-132 55 349

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10260|YD2C_SCHPO Uncharacterized protein C56F8.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.12 PE=4 SV=1 48 367 7.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 101 123 22
2 143 165 22
3 175 197 22
4 224 246 22
5 274 296 22
6 317 339 22
7 349 368 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4269
MVAPLLPELLPALAGRSLTGRDLLAFPGGDNETDTVFGGVHFNLTTLRFWNYTYYSNQTLSNGTKCWLTFPPYQP
HELLTNGTFVNATKCWTALDPIGTRGVTGIVFAALYGLGLVMTLAALAKHGALYLPKEKRFFPIGRRWQWYWGGF
VGACALIGLLSNIDIDRYYVQELPIVLTSFFWFLLCQGTMALTWEAVRHWGSWLERQYVDPNPFIYRQDDRRAMI
EFWMPLWFYFWVWMNFFLVVPRSWKFAEKQRSPDQTRDVAIPAATGGRFKGAAVCLVIAWLTILFSLRHSVQHYK
PRNRGLANRVVGLARALPVRFMFMIPLCLAMIIYQIVIAFVWDLSVMRYRGVVPIIFAWGYGPPLLIMS*
Coding >Hirsu2|4269
ATGGTGGCACCACTGCTGCCCGAGCTGCTGCCCGCGCTGGCCGGCCGCTCGCTGACCGGCCGCGACCTGCTGGCG
TTCCCCGGCGGCGACAACGAGACGGACACGGTCTTTGGCGGCGTGCACTTCAACCTGACGACGCTGCGCTTCTGG
AACTACACCTACTACAGCAACCAGACGCTGTCCAACGGCACCAAGTGCTGGCTGACGTTCCCGCCGTACCAGCCG
CACGAGCTGCTGACCAACGGCACCTTCGTCAACGCGACCAAGTGCTGGACGGCGCTCGACCCCATCGGCACCCGC
GGCGTCACCGGCATCGTCTTCGCCGCCCTCTACGGCCTCGGCCTGGTCATGACGCTGGCCGCGCTGGCCAAGCAC
GGCGCGCTGTACCTGCCCAAGGAGAAGCGCTTCTTCCCCATCGGCCGGCGCTGGCAGTGGTACTGGGGCGGCTTC
GTCGGCGCCTGCGCCCTCATCGGCCTGCTCTCCAACATCGACATCGACCGCTACTACGTCCAGGAGCTGCCCATC
GTCCTCACCAGCTTCTTCTGGTTCCTGCTCTGCCAGGGCACCATGGCCCTGACCTGGGAGGCCGTCCGCCACTGG
GGCAGCTGGCTGGAGCGCCAGTATGTCGACCCGAACCCGTTCATCTATCGCCAGGACGACCGCCGGGCCATGATT
GAGTTTTGGATGCCGCTCTGGTTCTACTTTTGGGTCTGGATGAACTTCTTCCTCGTCGTCCCGCGCAGCTGGAAG
TTTGCCGAGAAGCAGCGGTCGCCGGACCAGACGCGCGACGTGGCGATCCCGGCGGCGACGGGCGGCCGGTTCAAG
GGCGCGGCCGTGTGCCTCGTCATCGCCTGGCTCACCATCCTCTTCTCGCTGCGGCACTCGGTGCAGCACTACAAG
CCGCGCAACCGCGGGCTGGCCAACCGGGTGGTGGGCCTGGCGCGGGCGCTGCCGGTGCGCTTCATGTTCATGATC
CCGCTGTGCCTGGCCATGATCATCTACCAGATCGTCATCGCCTTCGTCTGGGACCTGTCGGTGATGCGGTACCGC
GGCGTGGTGCCCATCATCTTCGCCTGGGGCTACGGCCCGCCGCTGCTGATCATGAGCTGA
Transcript >Hirsu2|4269
ATGGTGGCACCACTGCTGCCCGAGCTGCTGCCCGCGCTGGCCGGCCGCTCGCTGACCGGCCGCGACCTGCTGGCG
TTCCCCGGCGGCGACAACGAGACGGACACGGTCTTTGGCGGCGTGCACTTCAACCTGACGACGCTGCGCTTCTGG
AACTACACCTACTACAGCAACCAGACGCTGTCCAACGGCACCAAGTGCTGGCTGACGTTCCCGCCGTACCAGCCG
CACGAGCTGCTGACCAACGGCACCTTCGTCAACGCGACCAAGTGCTGGACGGCGCTCGACCCCATCGGCACCCGC
GGCGTCACCGGCATCGTCTTCGCCGCCCTCTACGGCCTCGGCCTGGTCATGACGCTGGCCGCGCTGGCCAAGCAC
GGCGCGCTGTACCTGCCCAAGGAGAAGCGCTTCTTCCCCATCGGCCGGCGCTGGCAGTGGTACTGGGGCGGCTTC
GTCGGCGCCTGCGCCCTCATCGGCCTGCTCTCCAACATCGACATCGACCGCTACTACGTCCAGGAGCTGCCCATC
GTCCTCACCAGCTTCTTCTGGTTCCTGCTCTGCCAGGGCACCATGGCCCTGACCTGGGAGGCCGTCCGCCACTGG
GGCAGCTGGCTGGAGCGCCAGTATGTCGACCCGAACCCGTTCATCTATCGCCAGGACGACCGCCGGGCCATGATT
GAGTTTTGGATGCCGCTCTGGTTCTACTTTTGGGTCTGGATGAACTTCTTCCTCGTCGTCCCGCGCAGCTGGAAG
TTTGCCGAGAAGCAGCGGTCGCCGGACCAGACGCGCGACGTGGCGATCCCGGCGGCGACGGGCGGCCGGTTCAAG
GGCGCGGCCGTGTGCCTCGTCATCGCCTGGCTCACCATCCTCTTCTCGCTGCGGCACTCGGTGCAGCACTACAAG
CCGCGCAACCGCGGGCTGGCCAACCGGGTGGTGGGCCTGGCGCGGGCGCTGCCGGTGCGCTTCATGTTCATGATC
CCGCTGTGCCTGGCCATGATCATCTACCAGATCGTCATCGCCTTCGTCTGGGACCTGTCGGTGATGCGGTACCGC
GGCGTGGTGCCCATCATCTTCGCCTGGGGCTACGGCCCGCCGCTGCTGATCATGAGCTGA
Gene >Hirsu2|4269
ATGGTGGCACCACTGCTGCCCGAGCTGCTGCCCGCGCTGGCCGGCCGCTCGCTGACCGGCCGCGACCTGCTGGCG
TTCCCCGGCGGCGACAACGAGACGGACACGGTCTTTGGCGGCGTGCACTTCAACCTGACGACGCTGCGCTTCTGG
AACTACACCTACTACAGCAACCAGACGCTGTCCAACGGCACCAAGTGCTGGCTGACGTTCCCGCCGTACCAGCCG
CACGAGCTGCTGACCAACGGCACCTTCGTCAACGCGACCAAGTGCTGGACGGCGCTCGACCCCATCGGCACCCGC
GGCGTCACCGGCATCGTCTTCGCCGCCCTCTACGGCCTCGGCCTGGTCATGACGCTGGCCGCGCTGGCCAAGCAC
GGCGCGCTGTACCTGCCCAAGGAGAAGCGCTTCTTCCCCATCGGCCGGCGCTGGCAGTGGTACTGGGGCGGCTTC
GTCGGCGCCTGCGCCCTCATCGGCCTGCTCTCCAACATCGACATCGACCGCTACTACGTCCAGGAGCTGCCCATC
GTCCTCACCAGCTTCTTCTGGTTCCTGCTCTGCCAGGGCACCATGGCCCTGACCTGGGAGGCCGTCCGCCACTGG
GGCAGCTGGCTGGAGCGCCAGTATGTCGACCCGAACCCGTTCATCTATCGCCAGGACGACCGCCGGGCCATGATT
GAGTTTTGGATGCCGCTCTGGTTCTACTTTTGGGTCTGGATGGTACGTCTTTTCTCCTCGTCTTCCTTCCTCTCT
CCCTCTCTCCCTCTCTCCCTCTCTCACTCCCTCACTCGTGTGTGTGAGTATGCGTGCGTGTGTGTGTGTGGGTGT
GCTGAAAAGTATGTATGCTCATGCCCGTCGCAACAGAACTTCTTCCTCGTCGTCCCGCGCAGCTGGAAGTTTGCC
GAGAAGCAGCGGTCGCCGGACCAGACGCGCGACGTGGCGATCCCGGCGGCGACGGGCGGCCGGTTCAAGGGCGCG
GCCGTGTGCCTCGTCATCGCCTGGCTCACCATCCTCTTCTCGCTGCGGCACTCGGTGCAGCACTACAAGCCGCGC
AACCGCGGGCTGGCCAACCGGGTGGTGGGCCTGGCGCGGGCGCTGCCGGTGCGCTTCATGTTCATGATCCCGCTG
TGCCTGGCCATGATCATCTACCAGATCGTCATCGCCTTCGTCTGGGACCTGTCGGTGATGCGGTACCGCGGCGTG
GTGCCCATCATCTTCGCCTGGGGCTACGGCCCGCCGCTGCTGATCATGTACATCCAGCTGGCCTACGGCTTCTTC
AGCCCCAACGAGGACAAGGAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail