Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4266
Gene name
LocationContig_219:26469..26803
Strand+
Gene length (bp)334
Transcript length (bp)270
Coding sequence length (bp)270
Protein length (aa) 90

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 12 89 2.0E-16
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 29 89 4.0E-16
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 29 89 4.0E-16
sp|B8NP65|BGLF_ASPFN Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglF PE=3 SV=1 43 89 9.0E-15
sp|Q0CI67|BGLF_ASPTN Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglF PE=3 SV=1 1 89 9.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 12 89 2.0E-16
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 29 89 4.0E-16
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 29 89 4.0E-16
sp|B8NP65|BGLF_ASPFN Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglF PE=3 SV=1 43 89 9.0E-15
sp|Q0CI67|BGLF_ASPTN Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglF PE=3 SV=1 1 89 9.0E-15
sp|Q2UN12|BGLF_ASPOR Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglF PE=3 SV=1 43 89 9.0E-15
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 43 89 1.0E-14
sp|A1D451|BGLA_NEOFI Probable beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglA PE=3 SV=1 18 85 1.0E-09
sp|B0XPE1|BGLA_ASPFC Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglA PE=3 SV=1 18 85 2.0E-09
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 18 85 2.0E-09
sp|P87076|BGLA_ASPKW Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=bglA PE=1 SV=2 36 85 9.0E-09
sp|A2RAL4|BGLA_ASPNC Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglA PE=3 SV=1 36 85 1.0E-08
sp|Q0CTD7|BGLA_ASPTN Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglA PE=3 SV=1 18 85 3.0E-08
sp|P48825|BGL1_ASPAC Beta-glucosidase 1 OS=Aspergillus aculeatus PE=1 SV=1 36 85 4.0E-08
sp|Q0C7L4|BGLM_ASPTN Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglM PE=3 SV=1 17 84 7.0E-08
sp|D0VKF5|BGLA_ASPTE Probable beta-glucosidase A OS=Aspergillus terreus GN=bglA PE=2 SV=1 43 85 3.0E-07
sp|P06835|BGLS_WICAO Beta-glucosidase OS=Wickerhamomyces anomalus PE=3 SV=1 1 85 4.0E-07
sp|A1CR85|BGLA_ASPCL Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglA PE=3 SV=1 43 88 6.0E-07
sp|B8NRX2|BGLA_ASPFN Probable beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglA PE=3 SV=1 43 85 6.0E-07
sp|Q2UUD6|BGLA_ASPOR Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglA PE=3 SV=1 43 85 6.0E-07
sp|A1CMH6|BGLE_ASPCL Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglE PE=3 SV=1 43 89 1.0E-06
sp|D4AN50|BGLA_ARTBC Probable beta-glucosidase ARB_05654 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05654 PE=1 SV=1 34 85 2.0E-06
sp|P22507|BGL2_SACFI Beta-glucosidase 2 OS=Saccharomycopsis fibuligera GN=BGL2 PE=3 SV=1 43 89 2.0E-06
sp|P22506|BGL1_SACFI Beta-glucosidase 1 OS=Saccharomycopsis fibuligera GN=BGL1 PE=3 SV=1 43 85 4.0E-06
sp|Q5AYH8|BGLE_EMENI Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglE PE=3 SV=1 46 89 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4266
MPPPGLWAVLGLAATALATTLAGSSPATASDELAGTAEERFESPPYYPAPYGGWDASWAVSYREARAVVAGMTLA
EKTNLTSGTGIFMG*
Coding >Hirsu2|4266
ATGCCCCCTCCCGGCCTCTGGGCCGTGCTCGGCCTCGCGGCCACGGCCCTCGCCACGACGCTCGCCGGCTCGAGC
CCGGCGACGGCTAGCGATGAGCTCGCCGGCACGGCCGAGGAGCGGTTCGAATCCCCACCCTACTACCCGGCGCCG
TACGGCGGCTGGGACGCCAGCTGGGCCGTCAGCTACCGCGAGGCCCGCGCCGTCGTCGCCGGCATGACGCTGGCG
GAGAAGACGAACCTGACCAGCGGCACCGGCATCTTTATGGGGTGA
Transcript >Hirsu2|4266
ATGCCCCCTCCCGGCCTCTGGGCCGTGCTCGGCCTCGCGGCCACGGCCCTCGCCACGACGCTCGCCGGCTCGAGC
CCGGCGACGGCTAGCGATGAGCTCGCCGGCACGGCCGAGGAGCGGTTCGAATCCCCACCCTACTACCCGGCGCCG
TACGGCGGCTGGGACGCCAGCTGGGCCGTCAGCTACCGCGAGGCCCGCGCCGTCGTCGCCGGCATGACGCTGGCG
GAGAAGACGAACCTGACCAGCGGCACCGGCATCTTTATGGGGTGA
Gene >Hirsu2|4266
ATGCCCCCTCCCGGCCTCTGGGCCGTGCTCGGCCTCGCGGCCACGGCCCTCGCCACGACGCTCGCCGGCTCGAGC
CCGGCGACGGCTAGCGATGAGCTCGCCGGCACGGCCGAGGAGCGGTTCGAATCCCCACCCTACTACCCGGCGCCG
TACGGCGGCTGGGACGCCAGCTGGGCCGTCAGCTACCGCGAGGCCCGCGCCGTCGTCGCCGGCATGACGCTGGCG
GAGAAGACGAACCTGACCAGCGGCACCGGCATCTTTATGGGTACGTTGGACGTTCGGGCTGGTGGTCGTTGCTGG
TTATGGGCTGACGAGAAATTCATGGACAGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail