Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4264
Gene name
LocationContig_219:23311..24441
Strand-
Gene length (bp)1130
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09258 Glyco_transf_64 Glycosyl transferase family 64 domain 1.4E-51 84 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XZ08|EXT3_DROME Exostosin-3 OS=Drosophila melanogaster GN=botv PE=1 SV=1 78 323 1.0E-32
sp|Q9WVL6|EXTL3_MOUSE Exostosin-like 3 OS=Mus musculus GN=Extl3 PE=1 SV=2 78 322 6.0E-31
sp|O43909|EXTL3_HUMAN Exostosin-like 3 OS=Homo sapiens GN=EXTL3 PE=1 SV=1 78 322 1.0E-30
sp|Q9ES89|EXTL2_MOUSE Exostosin-like 2 OS=Mus musculus GN=Extl2 PE=1 SV=1 82 321 2.0E-27
sp|Q93063|EXT2_HUMAN Exostosin-2 OS=Homo sapiens GN=EXT2 PE=1 SV=1 84 321 6.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9XZ08|EXT3_DROME Exostosin-3 OS=Drosophila melanogaster GN=botv PE=1 SV=1 78 323 1.0E-32
sp|Q9WVL6|EXTL3_MOUSE Exostosin-like 3 OS=Mus musculus GN=Extl3 PE=1 SV=2 78 322 6.0E-31
sp|O43909|EXTL3_HUMAN Exostosin-like 3 OS=Homo sapiens GN=EXTL3 PE=1 SV=1 78 322 1.0E-30
sp|Q9ES89|EXTL2_MOUSE Exostosin-like 2 OS=Mus musculus GN=Extl2 PE=1 SV=1 82 321 2.0E-27
sp|Q93063|EXT2_HUMAN Exostosin-2 OS=Homo sapiens GN=EXT2 PE=1 SV=1 84 321 6.0E-27
sp|O77783|EXT2_BOVIN Exostosin-2 OS=Bos taurus GN=EXT2 PE=1 SV=1 84 321 7.0E-27
sp|P70428|EXT2_MOUSE Exostosin-2 OS=Mus musculus GN=Ext2 PE=1 SV=2 84 321 1.0E-26
sp|Q9Y169|EXT2_DROME Exostosin-2 OS=Drosophila melanogaster GN=Ext2 PE=1 SV=1 84 321 2.0E-26
sp|Q9UBQ6|EXTL2_HUMAN Exostosin-like 2 OS=Homo sapiens GN=EXTL2 PE=1 SV=1 82 321 3.0E-26
sp|Q84WB7|GT645_ARATH Glycosyltransferase family protein 64 protein C5 OS=Arabidopsis thaliana GN=At5g04500 PE=2 SV=1 83 319 4.0E-25
sp|O01705|EXT2_CAEEL Exostosin-2 OS=Caenorhabditis elegans GN=rib-2 PE=2 SV=2 78 321 2.0E-24
sp|Q5IGR6|EXT1C_DANRE Exostosin-1c OS=Danio rerio GN=ext1c PE=2 SV=1 114 321 2.0E-17
sp|Q9LY62|GT644_ARATH Glycosyltransferase family 64 protein C4 OS=Arabidopsis thaliana GN=EPC1 PE=2 SV=1 84 322 3.0E-15
sp|Q9V730|EXT1_DROME Exostosin-1 OS=Drosophila melanogaster GN=ttv PE=1 SV=1 145 329 7.0E-14
sp|Q5IGR8|EXT1A_DANRE Exostosin-1a OS=Danio rerio GN=ext1a PE=2 SV=1 114 329 8.0E-14
sp|Q9C975|GT643_ARATH Glycosyltransferase family protein 64 C3 OS=Arabidopsis thaliana GN=At1g80290 PE=2 SV=1 149 332 1.0E-13
sp|Q5IGR7|EXT1B_DANRE Exostosin-1b OS=Danio rerio GN=ext1b PE=2 SV=1 114 329 1.0E-13
sp|Q5RBC3|EXT1_PONAB Exostosin-1 OS=Pongo abelii GN=EXT1 PE=2 SV=1 114 329 1.0E-13
sp|Q16394|EXT1_HUMAN Exostosin-1 OS=Homo sapiens GN=EXT1 PE=1 SV=2 114 329 2.0E-12
sp|A9X1C8|EXT1_PAPAN Exostosin-1 OS=Papio anubis GN=EXT1 PE=3 SV=1 114 329 2.0E-12
sp|P97464|EXT1_MOUSE Exostosin-1 OS=Mus musculus GN=Ext1 PE=1 SV=1 114 329 2.0E-12
sp|A5D7I4|EXT1_BOVIN Exostosin-1 OS=Bos taurus GN=EXT1 PE=2 SV=1 114 329 2.0E-12
sp|Q9JK82|EXT1_CRIGR Exostosin-1 OS=Cricetulus griseus GN=EXT1 PE=1 SV=1 114 329 2.0E-12
sp|Q9JKV7|EXTL1_MOUSE Exostosin-like 1 OS=Mus musculus GN=Extl1 PE=2 SV=2 114 329 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016757 transferase activity, transferring glycosyl groups Yes
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044425 membrane part No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4264
MDAPAHSRLSSRALRRLTVALVAFSSTAILALGLFSLTPSGSLGSLRSPLAAPKHSQGQASCQASPDIWDAARLK
YRNLSDDKFTVALQTYHRERELAETLGVLLNTSIPSLLEVVVVWNDPDTTPPGDFASPHGVPVRYRHSPRNSLNE
KLWPDPAYQTQAVLLSDDDVYYRPDDLEFVFQTWRKFGRHRLTGALARCAAPRPDGSWEYSFCSRDAGNDAYSMI
LTNLAFAHVSLMDYYSSDDPAAQRVRSYVDDHFNCEDIALNFLASMLTGDGPLLVQGHERYVNMEPAQGISRKPH
HLEARSRCLSDLADILACMPLVNETAHVERGVVPL*
Coding >Hirsu2|4264
ATGGATGCGCCAGCCCACAGCCGCCTATCGTCGCGTGCCCTGCGCCGCTTGACCGTCGCCCTCGTCGCCTTTTCT
TCCACCGCCATCCTCGCCCTCGGCCTCTTCTCTCTCACCCCCTCCGGCAGCCTCGGCAGCCTCCGGAGCCCGTTG
GCAGCCCCCAAGCATAGCCAGGGCCAGGCTTCGTGCCAGGCCTCGCCCGACATCTGGGACGCGGCCCGCCTCAAG
TACCGCAACCTGAGCGATGACAAGTTCACCGTCGCCCTGCAAACGTACCACCGTGAACGCGAACTAGCCGAGACG
CTGGGCGTGCTGCTCAACACCAGCATCCCCTCGCTGCTCGAGGTCGTCGTCGTCTGGAACGACCCGGATACGACG
CCGCCCGGCGACTTCGCATCCCCCCACGGTGTCCCCGTCCGCTACAGGCACTCGCCGCGCAACAGCCTCAACGAG
AAGCTCTGGCCCGACCCGGCCTACCAGACGCAGGCCGTCCTCCTGTCCGACGATGACGTCTACTACCGCCCCGAC
GACCTCGAATTCGTCTTCCAGACCTGGCGCAAGTTTGGCCGGCACAGACTGACGGGCGCCCTCGCCCGCTGCGCC
GCGCCGCGCCCCGACGGCTCGTGGGAGTACAGCTTCTGCTCGCGCGACGCGGGCAACGACGCCTACTCCATGATC
CTCACCAACCTAGCCTTTGCCCACGTTTCCCTAATGGACTATTACTCGTCCGACGACCCGGCCGCCCAGAGGGTG
CGCAGCTACGTCGACGACCACTTCAACTGCGAGGACATTGCCCTCAACTTCCTCGCCTCCATGCTGACCGGCGAC
GGGCCCCTGCTCGTCCAGGGCCACGAGCGCTACGTCAACATGGAGCCTGCGCAGGGCATCAGCAGGAAGCCGCAT
CACTTGGAGGCCCGGAGCCGCTGTCTGTCGGACCTGGCCGATATCTTGGCGTGCATGCCGCTCGTCAACGAGACG
GCACACGTCGAGCGCGGCGTTGTGCCCCTCTGA
Transcript >Hirsu2|4264
ATGGATGCGCCAGCCCACAGCCGCCTATCGTCGCGTGCCCTGCGCCGCTTGACCGTCGCCCTCGTCGCCTTTTCT
TCCACCGCCATCCTCGCCCTCGGCCTCTTCTCTCTCACCCCCTCCGGCAGCCTCGGCAGCCTCCGGAGCCCGTTG
GCAGCCCCCAAGCATAGCCAGGGCCAGGCTTCGTGCCAGGCCTCGCCCGACATCTGGGACGCGGCCCGCCTCAAG
TACCGCAACCTGAGCGATGACAAGTTCACCGTCGCCCTGCAAACGTACCACCGTGAACGCGAACTAGCCGAGACG
CTGGGCGTGCTGCTCAACACCAGCATCCCCTCGCTGCTCGAGGTCGTCGTCGTCTGGAACGACCCGGATACGACG
CCGCCCGGCGACTTCGCATCCCCCCACGGTGTCCCCGTCCGCTACAGGCACTCGCCGCGCAACAGCCTCAACGAG
AAGCTCTGGCCCGACCCGGCCTACCAGACGCAGGCCGTCCTCCTGTCCGACGATGACGTCTACTACCGCCCCGAC
GACCTCGAATTCGTCTTCCAGACCTGGCGCAAGTTTGGCCGGCACAGACTGACGGGCGCCCTCGCCCGCTGCGCC
GCGCCGCGCCCCGACGGCTCGTGGGAGTACAGCTTCTGCTCGCGCGACGCGGGCAACGACGCCTACTCCATGATC
CTCACCAACCTAGCCTTTGCCCACGTTTCCCTAATGGACTATTACTCGTCCGACGACCCGGCCGCCCAGAGGGTG
CGCAGCTACGTCGACGACCACTTCAACTGCGAGGACATTGCCCTCAACTTCCTCGCCTCCATGCTGACCGGCGAC
GGGCCCCTGCTCGTCCAGGGCCACGAGCGCTACGTCAACATGGAGCCTGCGCAGGGCATCAGCAGGAAGCCGCAT
CACTTGGAGGCCCGGAGCCGCTGTCTGTCGGACCTGGCCGATATCTTGGCGTGCATGCCGCTCGTCAACGAGACG
GCACACGTCGAGCGCGGCGTTGTGCCCCTCTGA
Gene >Hirsu2|4264
ATGGATGCGCCAGCCCACAGCCGCCTATCGTCGCGTGCCCTGCGCCGCTTGACCGTCGCCCTCGTCGCCTTTTCT
TCCACCGCCATCCTCGCCCTCGGCCTCTTCTCTCTCACCCCCTCCGGCAGCCTCGGCAGCCTCCGGAGCCCGTTG
GCAGCCCCCAAGCATAGCCAGGGCCAGGCTTCGTGCCAGGCCTCGCCCGACATCTGGGACGCGGCCCGCCTCAAG
TACCGCAACCTGAGCGATGACAAGTTCACGTGCGTCTGATGCCCCTGGGCCACGTGCTGTTTCTCTGCATCTTTC
TTCTTCTTTTTCTTTTCCCATCTCTTTTGTTCCTCTTCCCTTTTTGCTTCCGGTTCTGTCTGCTCACCTCTTCCA
GCGTCGCCCTGCAAACGTACCACCGTGAACGCGAACTAGCCGAGACGCTGGGCGTGCTGCTCAACACCAGCATCC
CCTCGCTGCTCGAGGTCGTCGTCGTCTGGAACGACCCGGATACGACGCCGCCCGGCGACTTCGCATCCCCCCACG
GTGTCCCCGTCCGCTACAGGCACTCGCCGCGCAACAGCCTCAACGAGAAGCTCTGGCCCGACCCGGCCTACCAGA
CGCAGGCCGTCCTCCTGTCCGACGATGACGTCTACTACCGCCCCGACGACCTCGAATTCGTCTTCCAGACCTGGC
GCAAGTTTGGCCGGCACAGACTGACGGGCGCCCTCGCCCGCTGCGCCGCGCCGCGCCCCGACGGCTCGTGGGAGT
ACAGCTTCTGCTCGCGCGACGCGGGCAACGACGCCTACTCCATGATCCTCACCAACCTAGCCTTTGCCCACGTTT
CCCTAATGGACTATTACTCGTCCGACGACCCGGCCGCCCAGAGGGTGCGCAGCTACGTCGACGACCACTTCAACT
GCGAGGACATTGCCCTCAACTTCCTCGCCTCCATGCTGACCGGCGACGGGCCCCTGCTCGTCCAGGGCCACGAGC
GCTACGTCAACATGGAGCCTGCGCAGGGCATCAGCAGGAAGCCGCATCACTTGGAGGCCCGGAGCCGCTGTCTGT
CGGACCTGGCCGATATCTTGGCGTGCATGCCGCTCGTCAACGAGACGGCACACGTCGAGCGCGGCGTTGTGCCCC
TCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail