Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4256
Gene name
LocationContig_2188:535..1503
Strand-
Gene length (bp)968
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07967 zf-C3HC C3HC zinc finger-like 2.9E-35 98 236

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0043169 cation binding No
GO:0043229 intracellular organelle No
GO:0043167 ion binding No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No
GO:0044424 intracellular part No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4256
MNATKRKFNALLQGLSPPPPPSAAEAMNGADSRRVVSGAAAAAPVTHEALLQKRRRLGLPESTAPKALDRSGLAS
SLRRSGAGPRQPPAEPALVKYCPGDRDQLLRRLATFQELTDWTPKPDRVNEVQWAKRGWICQAKETVRCLLCHKE
LVVKLNRKDVDGQQVPVLVPSEIEDALVDKYCDLIVSSHQQDCLWRKRGCEDSLLRLSFSSARATLAALRTRYDE
LCSRAPFLPYQFNLRLPDDLDLDQAGRA*
Coding >Hirsu2|4256
ATGAACGCGACCAAGCGCAAGTTCAACGCTCTCCTCCAAGGCCTCAGCCCCCCGCCGCCGCCCTCCGCCGCCGAG
GCCATGAACGGCGCCGACTCGCGACGTGTCGTGTCCGGCGCCGCCGCCGCCGCGCCCGTGACCCACGAGGCGCTC
CTCCAGAAGCGCCGACGGCTCGGCCTGCCCGAGTCGACGGCGCCCAAGGCCCTGGACCGCTCCGGCCTCGCCTCG
TCGCTCCGCAGGTCGGGCGCCGGCCCGCGCCAGCCGCCCGCCGAGCCGGCCCTCGTCAAGTACTGCCCCGGCGAC
CGCGACCAGCTGCTGCGCCGCCTCGCCACCTTCCAGGAGCTGACCGACTGGACGCCCAAGCCGGACCGGGTCAAC
GAGGTGCAGTGGGCCAAGCGCGGCTGGATCTGCCAGGCCAAGGAGACGGTCCGCTGCCTGCTCTGCCACAAGGAG
CTCGTCGTCAAGCTCAATCGCAAGGACGTCGACGGCCAGCAGGTGCCGGTCCTGGTCCCGTCCGAGATCGAGGAT
GCCTTGGTGGACAAGTACTGTGACCTCATCGTCAGCTCCCACCAGCAGGACTGCCTCTGGCGGAAGCGAGGCTGC
GAAGACTCGCTGCTGCGCCTGTCCTTCTCCAGCGCGAGGGCAACGCTGGCGGCGCTGCGCACGAGATACGATGAG
CTCTGCTCCCGAGCGCCCTTCCTCCCCTACCAGTTCAACCTGCGCCTCCCCGACGACCTGGACCTGGACCAGGCT
GGCAGGGCCTGA
Transcript >Hirsu2|4256
ATGAACGCGACCAAGCGCAAGTTCAACGCTCTCCTCCAAGGCCTCAGCCCCCCGCCGCCGCCCTCCGCCGCCGAG
GCCATGAACGGCGCCGACTCGCGACGTGTCGTGTCCGGCGCCGCCGCCGCCGCGCCCGTGACCCACGAGGCGCTC
CTCCAGAAGCGCCGACGGCTCGGCCTGCCCGAGTCGACGGCGCCCAAGGCCCTGGACCGCTCCGGCCTCGCCTCG
TCGCTCCGCAGGTCGGGCGCCGGCCCGCGCCAGCCGCCCGCCGAGCCGGCCCTCGTCAAGTACTGCCCCGGCGAC
CGCGACCAGCTGCTGCGCCGCCTCGCCACCTTCCAGGAGCTGACCGACTGGACGCCCAAGCCGGACCGGGTCAAC
GAGGTGCAGTGGGCCAAGCGCGGCTGGATCTGCCAGGCCAAGGAGACGGTCCGCTGCCTGCTCTGCCACAAGGAG
CTCGTCGTCAAGCTCAATCGCAAGGACGTCGACGGCCAGCAGGTGCCGGTCCTGGTCCCGTCCGAGATCGAGGAT
GCCTTGGTGGACAAGTACTGTGACCTCATCGTCAGCTCCCACCAGCAGGACTGCCTCTGGCGGAAGCGAGGCTGC
GAAGACTCGCTGCTGCGCCTGTCCTTCTCCAGCGCGAGGGCAACGCTGGCGGCGCTGCGCACGAGATACGATGAG
CTCTGCTCCCGAGCGCCCTTCCTCCCCTACCAGTTCAACCTGCGCCTCCCCGACGACCTGGACCTGGACCAGGCT
GGCAGGGCCTGA
Gene >Hirsu2|4256
ATGAACGCGACCAAGCGCAAGTTCAACGCTCTCCTCCAAGGCCTCAGCCCCCCGCCGCCGCCCTCCGCCGCCGAG
GCCATGAACGGCGCCGACTCGCGACGTGTCGTGTCCGGCGCCGCCGCCGCCGCGCCCGTGACCCACGAGGCGCTC
CTCCAGAAGCGCCGACGGCTCGGCCTGCCCGAGTCGACGGCGCCCAAGGCCCTGGACCGCTCCGGCCTCGCCTCG
TCGCTCCGCAGGTCGGGCGCCGGCCCGCGCCAGCCGCCCGCCGAGCCGGCCCTCGTCAAGTACTGCCCCGGCGAC
CGCGACCAGCTGCTGCGCCGCCTCGCCACCTTCCAGGAGCTGACCGACTGGACGCCCAAGCCGGACCGGGTCAAC
GAGGTGCAGTGGGCCAAGCGCGGCTGGATCTGCCAGGCCAAGGAGACGGTCCGCTGCCTGCTCTGCCACAAGGAG
CTCGTCGTCAAGCTCAATCGCAAGGACGTCGACGGCCAGCAGGTGCCGGTCCTGGTCCCGTCCGAGATCGGTCAG
CGCTGATACCTTTCCCCTCACCTGTTCCGAGCTGACTGGGGACACGCAGAGGATGCCTTGGTGGACAAGTACTGT
GACCTCATCGTCAGCTCCCACCAGCAGGACTGCCTCTGGCGGAAGCGAGGCTGCGAAGGTACCATACACGCGCCT
CGACCTCGCCGCCCCACGGGCCTCTGTTCTGACCCTCCTTGTACACGCAGACTCGCTGCTGCGCCTGTCCTTCTC
CAGCGCGAGGGCAACGCTGGCGGCGCTGCGCACGAGATACGATGAGCTCTGCTCCCGAGCGCCCTTCCTCCCCTA
CCAGTTCAACCTGCGCCTCCCCGACGACCTGGACCTGGACCAGGTGCTCTCCTGGCTCCCGCCCGACTTCTTCGC
CGACGCGGCATGCTCCTCCGTCAACCGCACCGCCCTGGCCCTGGCCCTCATAGGCTGGCAGGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail