Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4251
Gene name
LocationContig_2184:1390..2932
Strand+
Gene length (bp)1542
Transcript length (bp)1230
Coding sequence length (bp)1230
Protein length (aa) 410

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 9.6E-23 36 399

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 9 408 5.0E-52
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 8 409 8.0E-47
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 5 407 1.0E-46
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 7 404 1.0E-45
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 4 409 4.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 9 408 5.0E-52
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 8 409 8.0E-47
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 5 407 1.0E-46
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 7 404 1.0E-45
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 4 409 4.0E-42
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 10 407 3.0E-31
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 10 397 4.0E-30
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 5 382 1.0E-25
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 12 407 7.0E-23
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 10 320 8.0E-22
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 18 320 5.0E-19
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 11 357 1.0E-17
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 18 311 2.0E-17
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 31 320 3.0E-17
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 23 316 1.0E-14
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 9 320 4.0E-14
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 17 408 1.0E-12
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 9 275 3.0E-12
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 37 340 1.0E-09
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 23 320 1.0E-09
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 16 240 3.0E-08
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 44 234 6.0E-08
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 9 279 2.0E-06
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 23 401 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 70 89 19
2 93 115 22
3 122 144 22
4 154 176 22
5 189 211 22
6 260 282 22
7 294 313 19
8 317 339 22
9 351 373 22
10 383 405 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4251
MAGPLKPGDEEDVCVDTSNADVRIRRAFDRRVMPLVCCLYVCSYLDRGNIGNAKTAGAQNALGLDSAQWAWVLNS
FYICYVAFGWTTMLWKMLPAHIFVSVLCVCWGAAAMSSGAARNMAELVVTRCFLGVFEVIFGCGAPYFLSLLYKR
RELAFRMSLLLGMMPLANTFASSLAYGITQVRGSLEPWRLLFIIEGCFSVALAPLVYLFLIDSPSTAPFLTLQDR
VLAVKRLQHRDTTAKDGVKWRQVLLAFCDYKNYVHAAIHFSANYSFAALSNFLPTIVHDMGHDPIRAQGLTAPAY
FAAFLLCLLTSYLSDRLWRRGPLLAATAALAVAGYALLAAVRDQSKANVRYAGVWLAACGAFPALSLNVTWLLNN
QGGDSKKGAGLAIFLTIGQCSSFVSSLVFPKSDA*
Coding >Hirsu2|4251
ATGGCCGGCCCCTTGAAGCCGGGGGACGAAGAGGACGTCTGCGTCGACACGAGCAATGCCGACGTGCGAATACGC
CGCGCTTTCGATCGCCGAGTCATGCCTCTGGTCTGCTGCCTCTACGTCTGCTCCTACCTGGACCGCGGCAACATC
GGCAACGCAAAGACGGCGGGCGCCCAGAACGCCCTCGGCCTCGACTCGGCCCAGTGGGCTTGGGTCCTTAACTCC
TTCTACATCTGCTACGTCGCCTTCGGATGGACGACGATGCTGTGGAAGATGCTGCCCGCTCATATCTTCGTCTCC
GTCCTCTGCGTCTGCTGGGGCGCAGCCGCCATGAGCTCCGGCGCCGCCCGCAACATGGCCGAACTCGTCGTCACC
CGATGCTTCCTCGGCGTCTTCGAAGTCATCTTCGGCTGCGGGGCCCCGTACTTCCTCTCGCTGCTGTACAAGCGG
CGCGAGCTGGCTTTCCGCATGTCCCTGCTTCTGGGCATGATGCCTCTGGCCAACACGTTTGCCTCCAGCCTCGCC
TACGGCATTACCCAGGTCCGCGGCTCTCTGGAGCCGTGGAGGCTCTTGTTCATTATAGAGGGATGCTTTTCCGTT
GCATTGGCTCCCCTCGTCTACCTCTTCCTCATCGATTCGCCTTCCACAGCCCCCTTCCTCACCTTACAAGACCGC
GTCTTGGCCGTCAAGCGGCTGCAGCACAGAGACACGACGGCCAAGGACGGCGTCAAGTGGCGGCAGGTGTTGCTG
GCGTTCTGCGACTACAAGAACTACGTCCACGCTGCCATCCACTTCAGCGCCAATTACTCCTTCGCCGCCCTATCC
AACTTCCTGCCCACCATCGTCCACGATATGGGCCACGACCCGATCAGAGCCCAGGGGCTGACGGCTCCGGCTTAC
TTCGCCGCCTTCCTGCTCTGCCTCCTCACCTCGTACCTGTCCGACAGGCTGTGGAGGCGGGGCCCGCTCCTGGCG
GCCACGGCGGCCCTTGCCGTTGCCGGCTACGCCCTGCTCGCCGCCGTCCGAGACCAGAGCAAGGCCAACGTCCGG
TACGCCGGCGTCTGGCTGGCGGCCTGCGGCGCCTTTCCGGCCCTGAGCCTCAACGTCACATGGCTCCTCAACAAC
CAGGGCGGCGACTCCAAGAAAGGCGCCGGCCTCGCCATATTTCTGACCATCGGACAATGTTCCTCCTTCGTCAGC
AGTCTCGTCTTCCCTAAGAGCGATGCGTAA
Transcript >Hirsu2|4251
ATGGCCGGCCCCTTGAAGCCGGGGGACGAAGAGGACGTCTGCGTCGACACGAGCAATGCCGACGTGCGAATACGC
CGCGCTTTCGATCGCCGAGTCATGCCTCTGGTCTGCTGCCTCTACGTCTGCTCCTACCTGGACCGCGGCAACATC
GGCAACGCAAAGACGGCGGGCGCCCAGAACGCCCTCGGCCTCGACTCGGCCCAGTGGGCTTGGGTCCTTAACTCC
TTCTACATCTGCTACGTCGCCTTCGGATGGACGACGATGCTGTGGAAGATGCTGCCCGCTCATATCTTCGTCTCC
GTCCTCTGCGTCTGCTGGGGCGCAGCCGCCATGAGCTCCGGCGCCGCCCGCAACATGGCCGAACTCGTCGTCACC
CGATGCTTCCTCGGCGTCTTCGAAGTCATCTTCGGCTGCGGGGCCCCGTACTTCCTCTCGCTGCTGTACAAGCGG
CGCGAGCTGGCTTTCCGCATGTCCCTGCTTCTGGGCATGATGCCTCTGGCCAACACGTTTGCCTCCAGCCTCGCC
TACGGCATTACCCAGGTCCGCGGCTCTCTGGAGCCGTGGAGGCTCTTGTTCATTATAGAGGGATGCTTTTCCGTT
GCATTGGCTCCCCTCGTCTACCTCTTCCTCATCGATTCGCCTTCCACAGCCCCCTTCCTCACCTTACAAGACCGC
GTCTTGGCCGTCAAGCGGCTGCAGCACAGAGACACGACGGCCAAGGACGGCGTCAAGTGGCGGCAGGTGTTGCTG
GCGTTCTGCGACTACAAGAACTACGTCCACGCTGCCATCCACTTCAGCGCCAATTACTCCTTCGCCGCCCTATCC
AACTTCCTGCCCACCATCGTCCACGATATGGGCCACGACCCGATCAGAGCCCAGGGGCTGACGGCTCCGGCTTAC
TTCGCCGCCTTCCTGCTCTGCCTCCTCACCTCGTACCTGTCCGACAGGCTGTGGAGGCGGGGCCCGCTCCTGGCG
GCCACGGCGGCCCTTGCCGTTGCCGGCTACGCCCTGCTCGCCGCCGTCCGAGACCAGAGCAAGGCCAACGTCCGG
TACGCCGGCGTCTGGCTGGCGGCCTGCGGCGCCTTTCCGGCCCTGAGCCTCAACGTCACATGGCTCCTCAACAAC
CAGGGCGGCGACTCCAAGAAAGGCGCCGGCCTCGCCATATTTCTGACCATCGGACAATGTTCCTCCTTCGTCAGC
AGTCTCGTCTTCCCTAAGAGCGATGCGTAA
Gene >Hirsu2|4251
ATGGCCGGCCCCTTGAAGCCGGGGGACGAAGAGGACGTCTGCGTCGACACGAGCAATGCCGACGTGCGAATACGC
CGCGCTGTACGTGCCGTGCTCCCCTTGAATCCCCCCCCCCCTCCTCCTCCACCACCACCACCACCACACCCGGTG
CTGAAGCAGGCCACTGCCAAGGTGAGACGAAGATGCGCTCGTCGTCATCCCCTGACCGTCCAGAACCTGCAGTTC
GATCGCCGAGTCATGCCTCTGGTCTGCTGCCTCTACGTCTGCTCCTACCTGGACCGCGGCAACATCGGCAACGCA
AAGACGGCGGGCGCCCAGAACGCCCTCGGCCTCGACTCGGCCCAGTGGGCTTGGGTCCTTAACTCCTTCTACATC
TGCTACGTCGCCTTCGGATGGACGACGATGCTGTGGAAGATGCTGCCCGCTCATATCTTCGTCTCCGTCCTCTGC
GTCTGGTACCTCGGAATTCCGTCCCCGTCTGCCTCGATATGCCCTCTCTTGCCTGCCTGCTGCTGACTGCGTTAC
AACAGCTGGGGCGCAGCCGCCATGAGCTCCGGCGCCGCCCGCAACATGGCCGAACTCGTCGTCACCCGATGCTTC
CTCGGCGTCTTCGAAGTCATCTTCGGCTGCGGGGCCCCGTACTTCCTCTCGCTGCTGTACAAGCGGCGCGAGCTG
GCTTTCCGCATGTCCCTGCTTCTGGGCATGATGCCTCTGGCCAACACGTTTGCCTCCAGCCTCGCCTACGGCATT
ACCCAGGTCCGCGGCTCTCTGGAGCCGTGGAGGCTCTTGTTCATTATAGGCACGCTCCGCACACCTCTCTCTCCA
CCCCTTTTCTTCCCCTCCTCTTCACTGTCTTTCCTCCGTAAGCTGGCCCGCCGGCTGATGGAACGTCCAGAGGGA
TGCTTTTCCGTTGCATTGGCTCCCCTCGTCTACCTCTTCCTCATCGATTCGCCTTCCACAGCCCCCTTCCTCACC
TTACAAGACCGCGTCTTGGCCGTCAAGCGGCTGCAGCACAGAGACACGACGGCCAAGGACGGCGTCAAGTGGCGG
CAGGTGTTGCTGGCGTTCTGCGACTACAAGAACTACGTCCACGCTGCCATCCACTTCAGCGCCAATTACTCCTTC
GCCGCCCTATCCAACTTCCTGCCCACCATCGTCCACGATATGGGCCACGACCCGATCAGAGCCCAGGGGCTGACG
GCTCCGGCTTACTTCGCCGCCTTCCTGCTCTGCCTCCTCACCTCGTACCTGTCCGACAGGCTGTGGAGGCGGGGC
CCGCTCCTGGCGGCCACGGCGGCCCTTGCCGTTGCCGGCTACGCCCTGCTCGCCGCCGTCCGAGACCAGAGCAAG
GCCAACGTCCGGTACGCCGGCGTCTGGCTGGCGGCCTGCGGCGCCTTTCCGGCCCTGAGCCTCAACGTCACATGG
CTCCTCAACAACCAGGGCGGCGACTCCAAGAAAGGCGCCGGCCTCGCCATATTTCTGACCATCGGACAATGTTCC
TCCTTCGTCAGCAGTCTCGTCTTCCCTAAGAGCGATGCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail