Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|425
Gene name
LocationContig_1085:3705..4657
Strand+
Gene length (bp)952
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12874 zf-met Zinc-finger of C2H2 type 1.7E-04 95 118
PF12874 zf-met Zinc-finger of C2H2 type 6.5E-04 196 220
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 7.3E-05 95 119
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.4E-02 96 116
PF13912 zf-C2H2_6 C2H2-type zinc finger 1.5E-02 195 215

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 4 250 1.0E-09
sp|Q9NUA8|ZBT40_HUMAN Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens GN=ZBTB40 PE=1 SV=4 40 249 3.0E-09
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 4 141 5.0E-09
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 4 214 1.0E-08
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 4 248 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 4 250 1.0E-09
sp|Q9NUA8|ZBT40_HUMAN Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens GN=ZBTB40 PE=1 SV=4 40 249 3.0E-09
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 4 141 5.0E-09
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 4 214 1.0E-08
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 4 248 2.0E-08
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 8 141 2.0E-08
sp|Q6P9Y7|ZFP82_MOUSE Zinc finger protein 82 OS=Mus musculus GN=Zfp82 PE=2 SV=1 1 253 2.0E-08
sp|Q1H9T6|ZBT48_MOUSE Zinc finger and BTB domain-containing protein 48 OS=Mus musculus GN=Zbtb48 PE=1 SV=1 7 257 2.0E-08
sp|P10074|ZBT48_HUMAN Zinc finger and BTB domain-containing protein 48 OS=Homo sapiens GN=ZBTB48 PE=1 SV=2 7 257 3.0E-08
sp|Q5R633|ZBT48_PONAB Zinc finger and BTB domain-containing protein 48 OS=Pongo abelii GN=ZBTB48 PE=2 SV=1 7 257 3.0E-08
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 4 141 3.0E-08
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 4 141 3.0E-08
sp|Q8N141|ZFP82_HUMAN Zinc finger protein 82 homolog OS=Homo sapiens GN=ZFP82 PE=2 SV=1 4 253 4.0E-08
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 4 245 5.0E-08
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 4 245 6.0E-08
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 38 141 7.0E-08
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 4 245 9.0E-08
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 4 245 9.0E-08
sp|Q9CXE0|PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus GN=Prdm5 PE=2 SV=2 2 141 1.0E-07
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 4 141 1.0E-07
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 4 245 1.0E-07
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 4 141 1.0E-07
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 4 141 1.0E-07
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 4 224 2.0E-07
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 4 245 2.0E-07
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 1 245 2.0E-07
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 4 245 2.0E-07
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 3 245 2.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 4 245 2.0E-07
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 4 245 3.0E-07
sp|P08970|SUHW_DROME Protein suppressor of hairy wing OS=Drosophila melanogaster GN=su(Hw) PE=1 SV=2 10 152 3.0E-07
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 4 247 3.0E-07
sp|Q6IV72|ZN425_HUMAN Zinc finger protein 425 OS=Homo sapiens GN=ZNF425 PE=1 SV=1 8 215 4.0E-07
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 8 245 4.0E-07
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 4 223 4.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 4 141 4.0E-07
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 4 248 5.0E-07
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 4 248 5.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 4 245 5.0E-07
sp|Q3B725|ZBT24_RAT Zinc finger and BTB domain-containing protein 24 OS=Rattus norvegicus GN=Zbtb24 PE=2 SV=1 4 143 5.0E-07
sp|Q08875|SUHW_DROAN Protein suppressor of hairy wing OS=Drosophila ananassae GN=su(Hw) PE=2 SV=1 10 152 5.0E-07
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 1 144 6.0E-07
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 4 245 7.0E-07
sp|Q9N003|ZN425_MACFA Zinc finger protein 425 (Fragment) OS=Macaca fascicularis GN=ZNF425 PE=2 SV=2 8 215 7.0E-07
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 4 236 8.0E-07
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 4 246 8.0E-07
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 4 148 9.0E-07
sp|Q52KB5|ZBT24_DANRE Zinc finger and BTB domain-containing protein 24 OS=Danio rerio GN=zbtb24 PE=2 SV=1 5 144 9.0E-07
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 4 245 1.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 4 245 1.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 4 245 1.0E-06
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 4 250 1.0E-06
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 4 245 1.0E-06
sp|P49711|CTCF_HUMAN Transcriptional repressor CTCF OS=Homo sapiens GN=CTCF PE=1 SV=1 38 228 1.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 10 142 1.0E-06
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 4 246 1.0E-06
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 8 250 1.0E-06
sp|Q9R1D1|CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus GN=Ctcf PE=2 SV=1 8 228 1.0E-06
sp|Q08705|CTCF_CHICK Transcriptional repressor CTCF OS=Gallus gallus GN=CTCF PE=1 SV=1 38 228 1.0E-06
sp|P18730|ZG58_XENLA Gastrula zinc finger protein XlCGF58.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 4 141 1.0E-06
sp|O43167|ZBT24_HUMAN Zinc finger and BTB domain-containing protein 24 OS=Homo sapiens GN=ZBTB24 PE=1 SV=2 4 143 1.0E-06
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 4 245 2.0E-06
sp|Q08875|SUHW_DROAN Protein suppressor of hairy wing OS=Drosophila ananassae GN=su(Hw) PE=2 SV=1 4 144 2.0E-06
sp|Q61164|CTCF_MOUSE Transcriptional repressor CTCF OS=Mus musculus GN=Ctcf PE=1 SV=2 38 228 2.0E-06
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 7 142 2.0E-06
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 4 245 2.0E-06
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 4 141 2.0E-06
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 4 245 2.0E-06
sp|Q08876|SUHW_DROVI Protein suppressor of hairy wing OS=Drosophila virilis GN=su(Hw) PE=2 SV=1 4 145 2.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 4 245 2.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 4 141 2.0E-06
sp|Q9QZP2|PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus GN=Prdm4 PE=2 SV=1 3 144 2.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 4 148 2.0E-06
sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 4 143 2.0E-06
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 4 141 2.0E-06
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 8 250 2.0E-06
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 4 141 3.0E-06
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 7 142 3.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 8 245 3.0E-06
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 9 246 3.0E-06
sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 3 171 3.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 4 141 3.0E-06
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 5 250 3.0E-06
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 8 245 3.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 4 148 4.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 10 245 4.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 8 144 4.0E-06
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 4 141 4.0E-06
sp|Q80V63|PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus GN=Prdm4 PE=2 SV=2 3 144 4.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 3 251 4.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 8 141 4.0E-06
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 4 248 5.0E-06
sp|O43830|ZNF73_HUMAN Zinc finger protein 73 OS=Homo sapiens GN=ZNF73 PE=3 SV=1 4 141 5.0E-06
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 4 141 5.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 8 141 5.0E-06
sp|Q5R5M1|PRDM4_PONAB PR domain zinc finger protein 4 OS=Pongo abelii GN=PRDM4 PE=2 SV=1 3 148 5.0E-06
sp|Q9UKN5|PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens GN=PRDM4 PE=1 SV=3 3 148 5.0E-06
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 4 245 5.0E-06
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 4 141 6.0E-06
sp|Q494X3|ZN404_HUMAN Zinc finger protein 404 OS=Homo sapiens GN=ZNF404 PE=1 SV=2 7 148 6.0E-06
sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 37 141 6.0E-06
sp|P16373|ZFP59_MOUSE Zinc finger protein 59 OS=Mus musculus GN=Zfp59 PE=2 SV=2 5 215 6.0E-06
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 4 141 7.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 32 248 8.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 4 245 8.0E-06
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 4 163 8.0E-06
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 4 141 8.0E-06
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 4 245 9.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 8 142 9.0E-06
sp|Q8N895|ZN366_HUMAN Zinc finger protein 366 OS=Homo sapiens GN=ZNF366 PE=1 SV=1 10 246 9.0E-06
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 8 252 9.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 4 163 9.0E-06
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 38 141 9.0E-06
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 8 144 1.0E-05
sp|Q3U288|ZN710_MOUSE Zinc finger protein 710 OS=Mus musculus GN=Znf710 PE=2 SV=1 8 143 1.0E-05
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 4 160 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|425
MPLGNPFFECGTCGKEFPSGWQARENHCYSTGHAQPDHECDTCHRWFRSRAACAQHMNDTGHWVKPCRPYACSLC
DDTWSSKGDLTQHEHYSHNYCADCRRVFQNLNNLKMHLNSHVHRGSTISCPFCSKSYTTATGLSHHLESGSCPKA
PFLDRDSIYRFIRSKDPHGSISKNLLEWNGSCQYEANDRSFNGDAFECYLCHREFRSLGGLNQHLNSPTHQQALY
HCPNRACRKDFKSLAGIINHLESESCGITRFDKIQAQVGDFIRGGRMLTL*
Coding >Hirsu2|425
ATGCCGCTGGGCAACCCCTTCTTCGAATGCGGCACCTGCGGCAAGGAATTCCCCTCGGGATGGCAAGCACGCGAA
AACCACTGCTACTCGACCGGCCACGCCCAGCCGGACCACGAATGCGACACCTGCCACAGATGGTTCCGAAGCCGG
GCCGCCTGCGCCCAGCACATGAACGACACCGGCCACTGGGTCAAGCCTTGCAGACCTTACGCCTGCTCGCTGTGC
GACGATACTTGGTCCTCGAAGGGGGATCTCACTCAGCATGAGCACTACAGCCACAACTACTGCGCTGACTGCCGG
CGGGTGTTCCAGAATCTCAACAACTTGAAGATGCATCTCAATTCCCACGTGCACCGAGGCAGCACCATCTCCTGC
CCCTTCTGCTCCAAGTCGTACACGACTGCCACGGGCCTCAGCCACCACCTCGAGAGCGGCTCGTGCCCCAAGGCC
CCCTTCCTCGACCGCGACTCGATCTACCGATTCATCCGGTCCAAAGACCCCCACGGCTCCATCTCCAAGAACCTC
CTCGAGTGGAACGGCTCTTGCCAGTACGAGGCAAACGATCGATCCTTCAACGGGGACGCCTTCGAATGTTATCTC
TGCCATCGCGAGTTCCGCAGTCTTGGCGGCCTGAATCAACACCTGAACTCGCCAACGCACCAGCAGGCCCTGTAT
CATTGCCCGAACCGCGCCTGTCGCAAGGACTTCAAGTCCCTCGCCGGCATCATCAACCACCTCGAGAGCGAGTCG
TGCGGCATCACCAGGTTCGACAAGATTCAGGCTCAGGTCGGCGACTTCATCCGCGGCGGGCGCATGCTCACCCTT
TGA
Transcript >Hirsu2|425
ATGCCGCTGGGCAACCCCTTCTTCGAATGCGGCACCTGCGGCAAGGAATTCCCCTCGGGATGGCAAGCACGCGAA
AACCACTGCTACTCGACCGGCCACGCCCAGCCGGACCACGAATGCGACACCTGCCACAGATGGTTCCGAAGCCGG
GCCGCCTGCGCCCAGCACATGAACGACACCGGCCACTGGGTCAAGCCTTGCAGACCTTACGCCTGCTCGCTGTGC
GACGATACTTGGTCCTCGAAGGGGGATCTCACTCAGCATGAGCACTACAGCCACAACTACTGCGCTGACTGCCGG
CGGGTGTTCCAGAATCTCAACAACTTGAAGATGCATCTCAATTCCCACGTGCACCGAGGCAGCACCATCTCCTGC
CCCTTCTGCTCCAAGTCGTACACGACTGCCACGGGCCTCAGCCACCACCTCGAGAGCGGCTCGTGCCCCAAGGCC
CCCTTCCTCGACCGCGACTCGATCTACCGATTCATCCGGTCCAAAGACCCCCACGGCTCCATCTCCAAGAACCTC
CTCGAGTGGAACGGCTCTTGCCAGTACGAGGCAAACGATCGATCCTTCAACGGGGACGCCTTCGAATGTTATCTC
TGCCATCGCGAGTTCCGCAGTCTTGGCGGCCTGAATCAACACCTGAACTCGCCAACGCACCAGCAGGCCCTGTAT
CATTGCCCGAACCGCGCCTGTCGCAAGGACTTCAAGTCCCTCGCCGGCATCATCAACCACCTCGAGAGCGAGTCG
TGCGGCATCACCAGGTTCGACAAGATTCAGGCTCAGGTCGGCGACTTCATCCGCGGCGGGCGCATGCTCACCCTT
TGA
Gene >Hirsu2|425
ATGCCGCTGGGCAACCCCTTCTTCGAATGCGGCACCTGCGGCAAGGAATTCCCCTCGGGATGGCAAGCACGCGAA
AACCACTGCTACTCGACCGGCCACGCCCAGCCGGACCACGAATGCGACACCTGCCACAGATGGTTCCGAAGCCGG
GCCGCCTGCGCCCAGCACATGAACGACACCGGCCACTGGGTCAAGCCTTGCAGACCTTACGCCTGCTCGCTGTGC
GACGATACTTGGTCCTCGAAGGGGGATCTCACTCAGCATGAGCACTACAGCCACAACTACTGCGCTGACTGCCGG
CGGGTGTTCCAGAATCTCAACAACTTGAAGATGGTGAGCTCCCTCTCCCGACTGCATCTCCCGCCCGGACGTCTC
AGCCGCTGATCCGGGCTCCAGCATCTCAATTCCCACGTGCACCGAGGCAGCACCATCTCCTGCCCCTTCTGCTCC
AAGTCGTACACGACTGCCACGGGCCTCAGCCACCACCTCGAGAGCGGCTCGTGCCCCAAGGCCCCCTTCCTCGAC
CGCGACTCGATCTACCGATTCATCCGGTCCAAAGACCCCCACGGCTCCATCTCCAAGAACCTCCTCGAGTGGAAC
GGCTCTTGCCAGTACGAGGCAAACGATCGATCCTTCAACGGGGACGCCTTCGAATGTTATCTCTGCCATCGCGAG
TTCCGCAGTCTTGGCGGCCTGAATCAACACCTGAACTCGCCAACGCGTAAGCCGGCCACCCATGCTCGGAGCTTT
CATCGCTTTGGCAGCTAATCCTCGGTCCGCAGACCAGCAGGCCCTGTATCATTGCCCGAACCGCGCCTGTCGCAA
GGACTTCAAGTCCCTCGCCGGCATCATCAACCACCTCGAGAGCGAGTCGTGCGGCATCACCAGGTTCGACAAGAT
TCAGGCTCAGGTCGGCGACTTCATCCGCGGCGGGCGCATGCTCACCCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail