Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4248
Gene name
LocationContig_2182:4..1399
Strand+
Gene length (bp)1395
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04438 zf-HIT HIT zinc finger 1.9E-06 4 31

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74906|BCD1_SCHPO Putative box C/D snoRNA protein SPCC613.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC613.07 PE=1 SV=1 5 159 6.0E-17
sp|Q9NWK9|BCD1_HUMAN Box C/D snoRNA protein 1 OS=Homo sapiens GN=ZNHIT6 PE=1 SV=1 2 155 1.0E-15
sp|Q5RF97|BCD1_PONAB Box C/D snoRNA protein 1 OS=Pongo abelii GN=ZNHIT6 PE=2 SV=1 2 157 2.0E-15
sp|Q3UFB2|BCD1_MOUSE Box C/D snoRNA protein 1 OS=Mus musculus GN=Znhit6 PE=1 SV=2 3 155 3.0E-15
sp|P38772|BCD1_YEAST Box C/D snoRNA protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCD1 PE=1 SV=1 1 159 1.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4248
LTTQCSICHTTAPRYRCPGCRLRTCSAACVRRHKAWSGCSGARDATAYVPRARLRTVAGVDHDYNFLHGLDLSRE
RAERVLVGDRGLVRASELRGRRGGRTAETRRAGGGTAERLLAHRLRRLGVELVAAPEGMARRRENGTTFHRRSGG
VNWAVEWLVWGDDEDEKRDEEEEEDDDKNRNRDGNGDKNRNKNKDDDNDKNRNKDDDNDKDAGAGPAERRLTRRL
SKVLESVPLHLAYQALREGKKTTTTTTTTARHGGHQHPHTSTWNAAGAAMQEPSTGRWIHLRGADAAGGPWPRER
TEAEQSQFQFFLGRPPTRSSLATTVTALAPTDCLRDALANTRVREFPTVYVLRAGQRLPAGFALGPKDMAAAAAA
PQQGAKRRAFPEAAAEDDESNGRRGPTKRRRKGDDDDGGPAGMEEGEVGSDEGGLDGATDGDEEPWAEDEDESPT
SSSGTDSDSEGTSS*
Coding >Hirsu2|4248
CTGACGACGCAGTGCTCCATCTGCCACACAACGGCGCCGCGGTACCGCTGCCCCGGGTGCCGGCTGCGGACGTGC
TCGGCGGCGTGCGTGCGGCGGCACAAGGCGTGGTCGGGGTGCAGCGGGGCGCGCGACGCGACGGCGTACGTGCCG
CGGGCGCGGCTGCGGACCGTCGCCGGCGTCGACCACGACTACAACTTCCTGCATGGCTTGGACCTGTCGCGCGAG
CGCGCCGAGCGGGTGCTGGTGGGCGACCGTGGCCTGGTGCGCGCCTCGGAGCTGCGCGGTAGGAGGGGGGGAAGA
ACCGCCGAGACGAGGAGGGCCGGGGGAGGGACCGCCGAGAGGTTGCTGGCGCACCGGCTGCGTAGGCTGGGCGTT
GAGCTTGTTGCCGCGCCGGAGGGGATGGCGAGGCGGCGTGAGAATGGGACGACGTTTCATCGGAGGTCGGGGGGG
GTGAATTGGGCGGTTGAGTGGCTCGTTTGGGGGGATGATGAGGATGAGAAGAGGGATGAGGAGGAGGAGGAGGAC
GACGACAAGAATAGGAACAGGGATGGCAACGGCGACAAGAACAGGAACAAGAACAAGGACGACGACAACGACAAG
AACAGGAACAAGGACGACGACAACGACAAGGACGCAGGCGCCGGCCCGGCAGAGCGCAGACTCACGAGACGACTG
TCCAAGGTGCTGGAGAGCGTGCCGCTCCACCTGGCCTACCAAGCGCTGCGCGAAGGGAAGAAGACGACGACGACG
ACGACGACGACAGCGCGACACGGCGGCCACCAGCACCCGCACACCTCGACCTGGAACGCGGCGGGCGCGGCGATG
CAGGAGCCCTCGACGGGCCGCTGGATACACTTGCGCGGCGCCGACGCGGCGGGCGGTCCGTGGCCGCGGGAGAGG
ACCGAGGCGGAGCAGTCCCAGTTCCAGTTCTTCCTCGGCCGGCCGCCGACGCGCTCCAGCCTCGCGACGACGGTC
ACGGCGCTGGCCCCGACGGACTGCCTGCGCGACGCCCTGGCCAACACCCGGGTGCGCGAGTTCCCCACCGTCTAC
GTCCTGCGCGCCGGCCAGCGGCTGCCGGCGGGCTTCGCGCTCGGGCCCAAGGACATGGCGGCGGCAGCGGCGGCA
CCGCAGCAAGGCGCCAAGCGCAGAGCCTTTCCCGAAGCCGCCGCCGAAGACGACGAATCGAACGGCCGCCGGGGG
CCGACCAAGCGGAGGAGGAAGGGAGATGACGACGACGGAGGGCCGGCAGGTATGGAGGAGGGAGAGGTCGGGAGC
GACGAGGGCGGGCTGGACGGGGCAACGGACGGAGACGAGGAGCCGTGGGCGGAGGACGAGGACGAGTCTCCCACC
AGCTCCTCCGGCACAGACAGTGACTCGGAGGGGACGAGCTCGTGA
Transcript >Hirsu2|4248
CTGACGACGCAGTGCTCCATCTGCCACACAACGGCGCCGCGGTACCGCTGCCCCGGGTGCCGGCTGCGGACGTGC
TCGGCGGCGTGCGTGCGGCGGCACAAGGCGTGGTCGGGGTGCAGCGGGGCGCGCGACGCGACGGCGTACGTGCCG
CGGGCGCGGCTGCGGACCGTCGCCGGCGTCGACCACGACTACAACTTCCTGCATGGCTTGGACCTGTCGCGCGAG
CGCGCCGAGCGGGTGCTGGTGGGCGACCGTGGCCTGGTGCGCGCCTCGGAGCTGCGCGGTAGGAGGGGGGGAAGA
ACCGCCGAGACGAGGAGGGCCGGGGGAGGGACCGCCGAGAGGTTGCTGGCGCACCGGCTGCGTAGGCTGGGCGTT
GAGCTTGTTGCCGCGCCGGAGGGGATGGCGAGGCGGCGTGAGAATGGGACGACGTTTCATCGGAGGTCGGGGGGG
GTGAATTGGGCGGTTGAGTGGCTCGTTTGGGGGGATGATGAGGATGAGAAGAGGGATGAGGAGGAGGAGGAGGAC
GACGACAAGAATAGGAACAGGGATGGCAACGGCGACAAGAACAGGAACAAGAACAAGGACGACGACAACGACAAG
AACAGGAACAAGGACGACGACAACGACAAGGACGCAGGCGCCGGCCCGGCAGAGCGCAGACTCACGAGACGACTG
TCCAAGGTGCTGGAGAGCGTGCCGCTCCACCTGGCCTACCAAGCGCTGCGCGAAGGGAAGAAGACGACGACGACG
ACGACGACGACAGCGCGACACGGCGGCCACCAGCACCCGCACACCTCGACCTGGAACGCGGCGGGCGCGGCGATG
CAGGAGCCCTCGACGGGCCGCTGGATACACTTGCGCGGCGCCGACGCGGCGGGCGGTCCGTGGCCGCGGGAGAGG
ACCGAGGCGGAGCAGTCCCAGTTCCAGTTCTTCCTCGGCCGGCCGCCGACGCGCTCCAGCCTCGCGACGACGGTC
ACGGCGCTGGCCCCGACGGACTGCCTGCGCGACGCCCTGGCCAACACCCGGGTGCGCGAGTTCCCCACCGTCTAC
GTCCTGCGCGCCGGCCAGCGGCTGCCGGCGGGCTTCGCGCTCGGGCCCAAGGACATGGCGGCGGCAGCGGCGGCA
CCGCAGCAAGGCGCCAAGCGCAGAGCCTTTCCCGAAGCCGCCGCCGAAGACGACGAATCGAACGGCCGCCGGGGG
CCGACCAAGCGGAGGAGGAAGGGAGATGACGACGACGGAGGGCCGGCAGGTATGGAGGAGGGAGAGGTCGGGAGC
GACGAGGGCGGGCTGGACGGGGCAACGGACGGAGACGAGGAGCCGTGGGCGGAGGACGAGGACGAGTCTCCCACC
AGCTCCTCCGGCACAGACAGTGACTCGGAGGGGACGAGCTCGTGA
Gene >Hirsu2|4248
CTGACGACGCAGTGCTCCATCTGCCACACAACGGCGCCGCGGTACCGCTGCCCCGGGTGCCGGCTGCGGACGTGC
TCGGCGGCGTGCGTGCGGCGGCACAAGGCGTGGTCGGGGTGCAGCGGGGCGCGCGACGCGACGGCGTACGTGCCG
CGGGCGCGGCTGCGGACCGTCGCCGGCGTCGACCACGACTACAACTTCCTGCATGGCTTGGACCTGTCGCGCGAG
CGCGCCGAGCGGGTGCTGGTGGGCGACCGTGGCCTGGTGCGCGCCTCGGAGCTGCGCGGTAGGAGGGGGGGAAGA
ACCGCCGAGACGAGGAGGGCCGGGGGAGGGACCGCCGAGAGGTTGCTGGCGCACCGGCTGCGTAGGCTGGGCGTT
GAGCTTGTTGCCGCGCCGGAGGGGATGGCGAGGCGGCGTGAGAATGGGACGACGTTTCATCGGAGGTCGGGGGGG
GTGAATTGGGCGGTTGAGTGGCTCGTTTGGGGGGATGATGAGGATGAGAAGAGGGATGAGGAGGAGGAGGAGGAC
GACGACAAGAATAGGAACAGGGATGGCAACGGCGACAAGAACAGGAACAAGAACAAGGACGACGACAACGACAAG
AACAGGAACAAGGACGACGACAACGACAAGGACGCAGGCGCCGGCCCGGCAGAGCGCAGACTCACGAGACGACTG
TCCAAGGTGCTGGAGAGCGTGCCGCTCCACCTGGCCTACCAAGCGCTGCGCGAAGGGAAGAAGACGACGACGACG
ACGACGACGACAGCGCGACACGGCGGCCACCAGCACCCGCACACCTCGACCTGGAACGCGGCGGGCGCGGCGATG
CAGGAGCCCTCGACGGGCCGCTGGATACACTTGCGCGGCGCCGACGCGGCGGGCGGTCCGTGGCCGCGGGAGAGG
ACCGAGGCGGAGCAGTCCCAGTTCCAGTTCTTCCTCGGCCGGCCGCCGACGCGCTCCAGCCTCGCGACGACGGTC
ACGGCGCTGGCCCCGACGGACTGCCTGCGCGACGCCCTGGCCAACACCCGGGTGCGCGAGTTCCCCACCGTCTAC
GTCCTGCGCGCCGGCCAGCGGCTGCCGGCGGGCTTCGCGCTCGGGCCCAAGGACATGGCGGCGGCAGCGGCGGCA
CCGCAGCAAGGCGCCAAGCGCAGAGCCTTTCCCGAAGCCGCCGCCGAAGACGACGAATCGAACGGCCGCCGGGGG
CCGACCAAGCGGAGGAGGAAGGGAGATGACGACGACGGAGGGCCGGCAGGTATGGAGGAGGGAGAGGTCGGGAGC
GACGAGGGCGGGCTGGACGGGGCAACGGACGGAGACGAGGAGCCGTGGGCGGAGGACGAGGACGAGTCTCCCACC
AGCTCCTCCGGCACAGACAGTGACTCGGAGGGGACGAGCTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail