Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4247
Gene name
LocationContig_2181:150..1133
Strand+
Gene length (bp)983
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 6.2E-14 45 127

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5A4E3|OCH1_CANAL Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OCH1 PE=3 SV=1 8 290 1.0E-92
sp|Q9UTR6|OCH1_SCHPO Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=och1 PE=1 SV=2 4 285 9.0E-80
sp|P47124|HOC1_YEAST Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOC1 PE=1 SV=3 8 285 4.0E-68
sp|P31755|OCH1_YEAST Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OCH1 PE=1 SV=1 10 295 8.0E-67

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4912 0.1757 0.2569 0.1229 0.4186 0.0696 0.2465 0.1736 0.1048 0.0951

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT32 6.5E-19 45 127

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2714
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|958
Ophiocordyceps australis map64 (Brazil) OphauB2|6430
Ophiocordyceps camponoti-floridani Ophcf2|03842
Ophiocordyceps camponoti-rufipedis Ophun1|3693
Ophiocordyceps kimflemingae Ophio5|7659
Ophiocordyceps subramaniannii Hirsu2|4247 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4247
MVDVSRLSTRDKLLYAYPYDVGSKFPAYIWQTWKSTPADNDFQFREQEASWTEQHPGFIHEVISDSVADSLLSLL
YAAVPEVLEAYRALPLPVLKADFFRYLILLARGGIYSDIDTYAIKSAVDWIPPHFPRDTIGLVVGIEADPDRPDW
SDWYSRRIQFCQWTIQSKPGHPVLRDVVARITNHTLALKRAGELSALPGKKVIEFTGPALWTDALMAYFNDDHYA
DTTKGRVDWHNFTGMDAPKRVGDVVVLPITSFSPGVEQMGSKDYDDPMAFVKHDFEGTWKPESERHIGEQKKEQA
PTT*
Coding >Hirsu2|4247
ATGGTGGATGTGTCGCGGCTGTCGACGCGCGACAAGCTGCTCTACGCCTACCCCTACGACGTCGGGTCCAAGTTC
CCGGCCTACATCTGGCAGACGTGGAAGTCGACGCCGGCCGACAATGACTTCCAGTTTCGCGAGCAGGAGGCGTCG
TGGACGGAGCAGCACCCCGGCTTCATCCACGAGGTCATCTCCGACTCGGTCGCCGACAGCCTGCTCAGCCTCCTC
TACGCCGCCGTGCCCGAGGTGCTTGAGGCCTACCGCGCCCTGCCGCTGCCCGTCCTCAAGGCCGACTTCTTCCGC
TACCTGATCCTGCTGGCCCGCGGCGGCATCTACTCCGACATCGACACGTACGCCATCAAGAGCGCCGTCGACTGG
ATCCCCCCGCACTTCCCGCGCGACACCATCGGTCTCGTCGTCGGCATCGAGGCCGACCCGGACCGCCCGGACTGG
TCCGACTGGTACAGCCGCCGCATCCAGTTTTGCCAGTGGACCATCCAGAGCAAGCCCGGCCACCCCGTCCTGCGC
GACGTCGTCGCCCGCATCACCAACCACACGCTGGCGCTCAAGCGCGCCGGCGAGCTGTCGGCCCTGCCGGGCAAG
AAGGTCATCGAATTCACCGGGCCCGCCCTCTGGACCGACGCGCTCATGGCCTACTTCAACGACGACCACTACGCC
GACACGACCAAGGGCCGCGTCGACTGGCACAACTTCACCGGCATGGACGCGCCCAAGCGCGTTGGCGACGTCGTC
GTCCTGCCCATCACCAGCTTCTCGCCCGGCGTCGAGCAGATGGGCTCCAAGGACTACGACGACCCCATGGCGTTT
GTCAAGCACGACTTTGAGGGCACGTGGAAGCCTGAGAGCGAAAGGCACATTGGCGAGCAGAAGAAGGAGCAGGCG
CCGACTACATGA
Transcript >Hirsu2|4247
ATGGTGGATGTGTCGCGGCTGTCGACGCGCGACAAGCTGCTCTACGCCTACCCCTACGACGTCGGGTCCAAGTTC
CCGGCCTACATCTGGCAGACGTGGAAGTCGACGCCGGCCGACAATGACTTCCAGTTTCGCGAGCAGGAGGCGTCG
TGGACGGAGCAGCACCCCGGCTTCATCCACGAGGTCATCTCCGACTCGGTCGCCGACAGCCTGCTCAGCCTCCTC
TACGCCGCCGTGCCCGAGGTGCTTGAGGCCTACCGCGCCCTGCCGCTGCCCGTCCTCAAGGCCGACTTCTTCCGC
TACCTGATCCTGCTGGCCCGCGGCGGCATCTACTCCGACATCGACACGTACGCCATCAAGAGCGCCGTCGACTGG
ATCCCCCCGCACTTCCCGCGCGACACCATCGGTCTCGTCGTCGGCATCGAGGCCGACCCGGACCGCCCGGACTGG
TCCGACTGGTACAGCCGCCGCATCCAGTTTTGCCAGTGGACCATCCAGAGCAAGCCCGGCCACCCCGTCCTGCGC
GACGTCGTCGCCCGCATCACCAACCACACGCTGGCGCTCAAGCGCGCCGGCGAGCTGTCGGCCCTGCCGGGCAAG
AAGGTCATCGAATTCACCGGGCCCGCCCTCTGGACCGACGCGCTCATGGCCTACTTCAACGACGACCACTACGCC
GACACGACCAAGGGCCGCGTCGACTGGCACAACTTCACCGGCATGGACGCGCCCAAGCGCGTTGGCGACGTCGTC
GTCCTGCCCATCACCAGCTTCTCGCCCGGCGTCGAGCAGATGGGCTCCAAGGACTACGACGACCCCATGGCGTTT
GTCAAGCACGACTTTGAGGGCACGTGGAAGCCTGAGAGCGAAAGGCACATTGGCGAGCAGAAGAAGGAGCAGGCG
CCGACTACATGA
Gene >Hirsu2|4247
ATGGTGGATGTGTCGCGGCTGTCGACGCGCGACAAGCTGCTCTACGCCTACCCCTACGACGTCGGGTCCAAGTTC
CCGGCCTACATCTGGCAGACGTGGAAGTCGACGCCGGCCGACAATGACTTCCAGTTTCGCGAGCAGGAGGCGTCG
TGGACGGAGCAGCACCCCGGCTTCATCCACGAGGTCATCTCCGACTCGGTCGCCGACAGCCTGCTCAGCCTCCTC
TACGCCGCCGTGCCCGAGGTGCTTGAGGCCTACCGCGCCCTGCCGCTGCCCGTCCTCAAGGCCGACTTCTTCCGC
TACCTGATCCTGCTGGCCCGCGGCGGCATCTACTCCGACATCGACACGTACGCCATCAAGAGCGCCGTCGACTGG
ATCCCCCCGCACTTCCCGCGCGACACCATCGGTCTCGTCGTCGGCATCGAGGCCGACCCGGACCGCCCGGACTGG
TCCGACTGGTACAGCCGCCGCATCCAGTTTTGCCAGTGGACCATCCAGAGCAAGCCCGGCCACCCCGTCCTGCGC
GACGTCGTCGCCCGCATCACCAACCACACGCTGGCGCTCAAGCGCGCCGGCGAGCTGTCGGCCCTGCCGGGCAAG
AAGGTCATCGAATTCACCGGGCCCGCCCTCTGGACCGACGCGCTCATGGCCTACTTCAACGACGACCACTACGCC
GACACGACCAAGGGCCGCGTCGACTGGCACAACTTCACCGGCATGGACGCGCCCAAGCGCGTTGGCGACGTCGTC
GTCCTGCCCATCACCAGCTTCTCGCCCGGCGTCGAGCAGATGGGCTCCAAGGACTACGACGACCCCATGGCGTTT
GTCAAGCACGACTTTGAGGGTTCGTCGTCCTCCGCTCTCCTCCACTTCCTCCCCTTGATGAGCTGATCGGTTGAC
TGACGGCATCTGCAGGCACGTGGAAGCCTGAGAGCGAAAGGCACATTGGCGAGCAGAAGAAGGAGCAGGCGCCGA
CTACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail