Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4235
Gene name
LocationContig_218:9828..11361
Strand-
Gene length (bp)1533
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01757 Acyl_transf_3 Acyltransferase family 1.0E-24 75 490

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups Yes
GO:0016746 transferase activity, transferring acyl groups No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 40 62 22
2 121 143 22
3 171 193 22
4 235 257 22
5 262 284 22
6 337 359 22
7 467 489 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4235
MQQQNPGPSNYHLEPMVLSFPSKRLRRLGTVPDLQRLLYAVRAYLSPVLVFLLPSFVQRWLWPDIFPPRRLSSTS
WLDGLRGVAAVPVILLHHTCLHFGSYSLPWGVENEGELASPIKLPFVRLVFSGDVMVHLFFIISGFAVSYKPLQC
VRRGDLDALARTVSSTAFRRGFRLFLPAFACCLGLAVLSRLGWVAQPPRLPTLAEQLWDLGTVCWKIGAVMPWAW
DAFDQPAYNYALWSIPIEYSCSLLLLVVVVGLSRLKPGLRLAFLLALVACCFKAGHWGAAEFLVGMGLAEANLIG
EATRDARGKADDDLPLSEDTLKPALFPSRPHVSARPTARLVVNAVLLGNLIFGLFLAGWTSSRDAVSRAPGLSWF
YSRTVEPYWSGEERAALNCWLFVAAVQIMLALQQIKPLQRPFVTPVAQYLGDISFSIYVVHVPWVHESGPVWMPY
VWAMVGGPDNLGVVRRLLAWLLSVVVLFIPIVWSGDVFWRLVDRNCVRFARWFEALCVKA*
Coding >Hirsu2|4235
ATGCAACAGCAAAATCCTGGCCCGTCCAACTACCACCTCGAACCCATGGTGCTGTCCTTCCCGTCCAAGCGGCTC
AGGAGGCTGGGGACGGTCCCCGACCTCCAGAGGCTGCTATACGCCGTCCGGGCGTACCTGTCGCCTGTGCTGGTC
TTCCTGCTGCCGTCATTCGTCCAGCGCTGGCTGTGGCCCGATATCTTCCCTCCTCGCCGGCTCTCGTCGACGTCG
TGGCTCGACGGCCTGCGCGGCGTGGCGGCCGTGCCCGTCATACTCCTGCACCACACCTGCCTCCATTTCGGCTCG
TACTCCTTGCCGTGGGGCGTCGAGAACGAGGGCGAGCTCGCATCGCCCATCAAGCTGCCCTTCGTGCGGCTGGTC
TTCAGCGGCGACGTCATGGTCCACCTCTTCTTCATCATCTCCGGCTTCGCCGTCTCGTATAAGCCGCTCCAGTGT
GTGCGGAGAGGAGACTTGGATGCCCTGGCCCGCACCGTCTCCAGCACCGCCTTTCGGCGCGGCTTCCGGCTCTTT
CTCCCCGCCTTCGCCTGCTGCCTCGGCTTGGCCGTCCTGAGCCGGCTCGGCTGGGTGGCACAGCCGCCACGCTTG
CCGACGCTGGCGGAGCAGCTATGGGACCTCGGAACGGTCTGTTGGAAGATCGGGGCCGTGATGCCCTGGGCCTGG
GACGCCTTCGACCAGCCGGCGTACAACTACGCCCTGTGGAGCATCCCGATCGAATACAGCTGCTCGCTGCTGCTG
CTCGTCGTCGTCGTCGGGCTCAGCCGGCTGAAGCCGGGCCTGCGGCTTGCCTTTCTGCTGGCCCTCGTAGCCTGC
TGCTTCAAGGCCGGCCACTGGGGCGCCGCCGAGTTTCTCGTCGGCATGGGGCTGGCCGAGGCGAATCTCATCGGG
GAGGCGACGCGCGACGCGAGGGGCAAGGCCGACGACGACCTGCCCCTGAGCGAGGACACATTGAAGCCGGCCCTG
TTCCCGTCGCGGCCGCACGTCTCGGCGCGGCCGACGGCCAGGCTCGTCGTCAACGCCGTGCTCCTCGGCAACCTC
ATCTTTGGCCTGTTCCTGGCCGGCTGGACCAGCAGCCGGGACGCCGTCTCGCGGGCGCCGGGCCTGTCGTGGTTC
TACTCGAGGACCGTCGAGCCGTACTGGAGCGGCGAGGAACGAGCCGCCTTGAACTGCTGGCTCTTCGTCGCGGCG
GTGCAGATCATGCTCGCGCTGCAGCAGATCAAGCCGCTGCAGAGGCCGTTTGTGACGCCCGTGGCGCAGTACCTG
GGCGACATCAGCTTCTCCATCTACGTCGTCCACGTCCCCTGGGTCCACGAATCGGGCCCCGTGTGGATGCCGTAC
GTCTGGGCCATGGTCGGCGGCCCGGACAACTTGGGCGTCGTCAGGCGGCTGCTGGCCTGGCTGCTGTCCGTTGTC
GTCCTCTTCATTCCCATTGTGTGGTCCGGCGATGTTTTCTGGCGGCTGGTAGACAGGAACTGCGTACGGTTTGCC
CGCTGGTTCGAGGCGCTGTGTGTGAAGGCTTAG
Transcript >Hirsu2|4235
ATGCAACAGCAAAATCCTGGCCCGTCCAACTACCACCTCGAACCCATGGTGCTGTCCTTCCCGTCCAAGCGGCTC
AGGAGGCTGGGGACGGTCCCCGACCTCCAGAGGCTGCTATACGCCGTCCGGGCGTACCTGTCGCCTGTGCTGGTC
TTCCTGCTGCCGTCATTCGTCCAGCGCTGGCTGTGGCCCGATATCTTCCCTCCTCGCCGGCTCTCGTCGACGTCG
TGGCTCGACGGCCTGCGCGGCGTGGCGGCCGTGCCCGTCATACTCCTGCACCACACCTGCCTCCATTTCGGCTCG
TACTCCTTGCCGTGGGGCGTCGAGAACGAGGGCGAGCTCGCATCGCCCATCAAGCTGCCCTTCGTGCGGCTGGTC
TTCAGCGGCGACGTCATGGTCCACCTCTTCTTCATCATCTCCGGCTTCGCCGTCTCGTATAAGCCGCTCCAGTGT
GTGCGGAGAGGAGACTTGGATGCCCTGGCCCGCACCGTCTCCAGCACCGCCTTTCGGCGCGGCTTCCGGCTCTTT
CTCCCCGCCTTCGCCTGCTGCCTCGGCTTGGCCGTCCTGAGCCGGCTCGGCTGGGTGGCACAGCCGCCACGCTTG
CCGACGCTGGCGGAGCAGCTATGGGACCTCGGAACGGTCTGTTGGAAGATCGGGGCCGTGATGCCCTGGGCCTGG
GACGCCTTCGACCAGCCGGCGTACAACTACGCCCTGTGGAGCATCCCGATCGAATACAGCTGCTCGCTGCTGCTG
CTCGTCGTCGTCGTCGGGCTCAGCCGGCTGAAGCCGGGCCTGCGGCTTGCCTTTCTGCTGGCCCTCGTAGCCTGC
TGCTTCAAGGCCGGCCACTGGGGCGCCGCCGAGTTTCTCGTCGGCATGGGGCTGGCCGAGGCGAATCTCATCGGG
GAGGCGACGCGCGACGCGAGGGGCAAGGCCGACGACGACCTGCCCCTGAGCGAGGACACATTGAAGCCGGCCCTG
TTCCCGTCGCGGCCGCACGTCTCGGCGCGGCCGACGGCCAGGCTCGTCGTCAACGCCGTGCTCCTCGGCAACCTC
ATCTTTGGCCTGTTCCTGGCCGGCTGGACCAGCAGCCGGGACGCCGTCTCGCGGGCGCCGGGCCTGTCGTGGTTC
TACTCGAGGACCGTCGAGCCGTACTGGAGCGGCGAGGAACGAGCCGCCTTGAACTGCTGGCTCTTCGTCGCGGCG
GTGCAGATCATGCTCGCGCTGCAGCAGATCAAGCCGCTGCAGAGGCCGTTTGTGACGCCCGTGGCGCAGTACCTG
GGCGACATCAGCTTCTCCATCTACGTCGTCCACGTCCCCTGGGTCCACGAATCGGGCCCCGTGTGGATGCCGTAC
GTCTGGGCCATGGTCGGCGGCCCGGACAACTTGGGCGTCGTCAGGCGGCTGCTGGCCTGGCTGCTGTCCGTTGTC
GTCCTCTTCATTCCCATTGTGTGGTCCGGCGATGTTTTCTGGCGGCTGGTAGACAGGAACTGCGTACGGTTTGCC
CGCTGGTTCGAGGCGCTGTGTGTGAAGGCTTAG
Gene >Hirsu2|4235
ATGCAACAGCAAAATCCTGGCCCGTCCAACTACCACCTCGAACCCATGGTGCTGTCCTTCCCGTCCAAGCGGCTC
AGGAGGCTGGGGACGGTCCCCGACCTCCAGAGGCTGCTATACGCCGTCCGGGCGTACCTGTCGCCTGTGCTGGTC
TTCCTGCTGCCGTCATTCGTCCAGCGCTGGCTGTGGCCCGATATCTTCCCTCCTCGCCGGCTCTCGTCGACGTCG
TGGCTCGACGGCCTGCGCGGCGTGGCGGCCGTGCCCGTCATACTCCTGCACCACACCTGCCTCCATTTCGGCTCG
TACTCCTTGCCGTGGGGCGTCGAGAACGAGGGCGAGCTCGCATCGCCCATCAAGCTGCCCTTCGTGCGGCTGGTC
TTCAGCGGCGACGTCATGGTCCACCTCTTCTTCATCATCTCCGGCTTCGCCGTCTCGTATAAGCCGCTCCAGTGT
GTGCGGAGAGGAGACTTGGATGCCCTGGCCCGCACCGTCTCCAGCACCGCCTTTCGGCGCGGCTTCCGGCTCTTT
CTCCCCGCCTTCGCCTGCTGCCTCGGCTTGGCCGTCCTGAGCCGGCTCGGCTGGGTGGCACAGCCGCCACGCTTG
CCGACGCTGGCGGAGCAGCTATGGGACCTCGGAACGGTCTGTTGGAAGATCGGGGCCGTGATGCCCTGGGCCTGG
GACGCCTTCGACCAGCCGGCGTACAACTACGCCCTGTGGAGCATCCCGATCGAATACAGCTGCTCGCTGCTGCTG
CTCGTCGTCGTCGTCGGGCTCAGCCGGCTGAAGCCGGGCCTGCGGCTTGCCTTTCTGCTGGCCCTCGTAGCCTGC
TGCTTCAAGGCCGGCCACTGGGGCGCCGCCGAGTTTCTCGTCGGCATGGGGCTGGCCGAGGCGAATCTCATCGGG
GAGGCGACGCGCGACGCGAGGGGCAAGGCCGACGACGACCTGCCCCTGAGCGAGGACACATTGAAGCCGGCCCTG
TTCCCGTCGCGGCCGCACGTCTCGGCGCGGCCGACGGCCAGGCTCGTCGTCAACGCCGTGCTCCTCGGCAACCTC
ATCTTTGGCCTGTTCCTGGCCGGCTGGACCAGCAGCCGGGACGCCGTCTCGCGGGCGCCGGGCCTGTCGTGGTTC
TACTCGAGGACCGTCGAGCCGTACTGGAGCGGCGAGGAACGAGCCGCCTTGAACTGCTGGCTCTTCGTCGCGGCG
GTGCAGATCATGCTCGCGCTGCAGCAGATCAAGCCGCTGCAGAGGCCGTTTGTGACGCCCGTGGCGCAGTACCTG
GGCGACATCAGCTTCTCCATCTACGTCGTCCACGTCCCCTGGGTCCACGAATCGGGCCCCGTGTGGATGCCGTAC
GTCTGGGCCATGGTCGGCGGCCCGGACAACTTGGGCGTCGTCAGGCGGCTGCTGGCCTGGCTGCTGTCCGTTGTC
GTCCTCTTCATTCCCATTGTGTGGTCCGGCGATGTTTTCTGGCGGCTGGTAGACAGGAACTGCGTACGGTTTGCC
CGCTGGTTCGAGGCGCTGTGTGTGAAGGCTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail