Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|423
Gene name
LocationContig_1084:7198..8035
Strand+
Gene length (bp)837
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12352 V-SNARE_C Snare region anchored in the vesicle membrane C-terminus 1.0E-13 145 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38736|GOSR1_YEAST Golgi SNAP receptor complex member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GOS1 PE=1 SV=1 9 230 3.0E-31
sp|Q2TBU3|GOSR1_BOVIN Golgi SNAP receptor complex member 1 OS=Bos taurus GN=GOSR1 PE=2 SV=1 7 231 2.0E-19
sp|O08522|GOSR1_CRIGR Golgi SNAP receptor complex member 1 OS=Cricetulus griseus GN=GOSR1 PE=1 SV=1 7 231 3.0E-19
sp|O95249|GOSR1_HUMAN Golgi SNAP receptor complex member 1 OS=Homo sapiens GN=GOSR1 PE=1 SV=1 7 231 3.0E-19
sp|Q62931|GOSR1_RAT Golgi SNAP receptor complex member 1 OS=Rattus norvegicus GN=Gosr1 PE=1 SV=1 7 231 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38736|GOSR1_YEAST Golgi SNAP receptor complex member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GOS1 PE=1 SV=1 9 230 3.0E-31
sp|Q2TBU3|GOSR1_BOVIN Golgi SNAP receptor complex member 1 OS=Bos taurus GN=GOSR1 PE=2 SV=1 7 231 2.0E-19
sp|O08522|GOSR1_CRIGR Golgi SNAP receptor complex member 1 OS=Cricetulus griseus GN=GOSR1 PE=1 SV=1 7 231 3.0E-19
sp|O95249|GOSR1_HUMAN Golgi SNAP receptor complex member 1 OS=Homo sapiens GN=GOSR1 PE=1 SV=1 7 231 3.0E-19
sp|Q62931|GOSR1_RAT Golgi SNAP receptor complex member 1 OS=Rattus norvegicus GN=Gosr1 PE=1 SV=1 7 231 4.0E-19
sp|Q5RBL6|GOSR1_PONAB Golgi SNAP receptor complex member 1 OS=Pongo abelii GN=GOSR1 PE=2 SV=1 7 231 4.0E-19
sp|O88630|GOSR1_MOUSE Golgi SNAP receptor complex member 1 OS=Mus musculus GN=Gosr1 PE=1 SV=2 7 231 5.0E-19
sp|O22151|GOS12_ARATH Golgi SNAP receptor complex member 1-2 OS=Arabidopsis thaliana GN=GOS12 PE=1 SV=2 13 231 5.0E-18
sp|Q9LMP7|GOS11_ARATH Golgi SNAP receptor complex member 1-1 OS=Arabidopsis thaliana GN=GOS11 PE=2 SV=1 14 231 4.0E-17
sp|Q09835|GOS1_SCHPO Protein transport protein gos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gos1 PE=3 SV=1 148 231 1.0E-11
sp|Q9VE50|GOSR1_DROME Golgi SNAP receptor complex member 1 OS=Drosophila melanogaster GN=Gos28 PE=2 SV=1 12 231 4.0E-09
sp|Q95ZW1|GOSR1_CAEEL Golgi SNAP receptor complex member 1 OS=Caenorhabditis elegans GN=gos-28 PE=2 SV=1 11 229 5.0E-08
sp|A8XLW0|GOSR1_CAEBR Golgi SNAP receptor complex member 1 OS=Caenorhabditis briggsae GN=gos-28 PE=3 SV=1 11 229 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 214 231 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|423
MSASASAPSASGGWAQLRQQARTLETQTENLFHTYSQFSAAATIPPDPTDEERQTESKIGELLEKRESTIAQLSR
LLDSEASLTSSALKQNNLSLLREKLSSHRRDLGRLRGALQQARDRANLLTNVRSDIDQYRANNPEAAEAEYMLNE
RNRIDNSHSMADSVLSQAYAVNDSFNLQRETLASINRRITLAASQVPGINSLIGRISAKKRRDGIIMGCFIATCF
LVFWWFM*
Coding >Hirsu2|423
ATGTCTGCCTCTGCCTCTGCGCCGTCGGCCAGCGGCGGCTGGGCCCAGCTGCGGCAGCAGGCCAGGACGCTCGAG
ACGCAGACGGAGAACCTCTTCCACACCTACTCGCAGTTTTCGGCGGCCGCGACCATCCCGCCGGACCCGACGGAC
GAGGAGCGCCAGACCGAGTCCAAGATCGGGGAGCTGCTGGAGAAGCGCGAATCCACCATCGCGCAGCTGTCGCGC
CTGCTCGACTCGGAGGCCTCCCTGACCTCGTCGGCGCTGAAGCAGAACAACCTGTCGCTGCTGCGCGAGAAGCTG
TCGTCGCACAGGCGCGACCTCGGCCGCCTCCGCGGCGCCCTGCAGCAGGCCCGCGACCGGGCCAACCTGTTGACC
AACGTCCGGTCCGACATCGACCAGTACCGCGCCAACAACCCCGAGGCGGCCGAGGCCGAGTACATGCTCAACGAG
CGCAACCGCATCGACAACAGCCACAGCATGGCCGACAGCGTGCTGAGCCAGGCCTACGCCGTCAACGACAGCTTC
AACCTCCAGAGGGAGACGCTGGCCAGCATCAACCGCAGGATCACCTTGGCCGCGAGCCAGGTGCCCGGCATCAAC
AGCCTCATCGGCAGGATATCGGCCAAGAAGCGGAGGGACGGCATCATCATGGGCTGCTTCATCGCCACCTGCTTC
CTCGTCTTCTGGTGGTTCATGTGA
Transcript >Hirsu2|423
ATGTCTGCCTCTGCCTCTGCGCCGTCGGCCAGCGGCGGCTGGGCCCAGCTGCGGCAGCAGGCCAGGACGCTCGAG
ACGCAGACGGAGAACCTCTTCCACACCTACTCGCAGTTTTCGGCGGCCGCGACCATCCCGCCGGACCCGACGGAC
GAGGAGCGCCAGACCGAGTCCAAGATCGGGGAGCTGCTGGAGAAGCGCGAATCCACCATCGCGCAGCTGTCGCGC
CTGCTCGACTCGGAGGCCTCCCTGACCTCGTCGGCGCTGAAGCAGAACAACCTGTCGCTGCTGCGCGAGAAGCTG
TCGTCGCACAGGCGCGACCTCGGCCGCCTCCGCGGCGCCCTGCAGCAGGCCCGCGACCGGGCCAACCTGTTGACC
AACGTCCGGTCCGACATCGACCAGTACCGCGCCAACAACCCCGAGGCGGCCGAGGCCGAGTACATGCTCAACGAG
CGCAACCGCATCGACAACAGCCACAGCATGGCCGACAGCGTGCTGAGCCAGGCCTACGCCGTCAACGACAGCTTC
AACCTCCAGAGGGAGACGCTGGCCAGCATCAACCGCAGGATCACCTTGGCCGCGAGCCAGGTGCCCGGCATCAAC
AGCCTCATCGGCAGGATATCGGCCAAGAAGCGGAGGGACGGCATCATCATGGGCTGCTTCATCGCCACCTGCTTC
CTCGTCTTCTGGTGGTTCATGTGA
Gene >Hirsu2|423
ATGTCTGCCTCTGCCTCTGCGCCGTCGGCCAGCGGCGGCTGGGCCCAGCTGCGGCAGCAGGCCAGGACGCTCGAG
ACGCAGGTGAGTCGACGGCCTGTCGTCGCCTCCGGGCCAGCCATGCTGACGGCCCCCCCAGACGGAGAACCTCTT
CCACACCTACTCGCAGTTTTCGGCGGCCGCGACCATCCCGCCGGACCCGACGGACGAGGAGCGCCAGACCGAGTC
CAAGATCGGGGAGCTGCTGGAGAAGGTCAGGATCCCTTCCCTTCCCGCTGGCCCGACGCCCCTCGTCCGCTCACC
AACCTCGTCTCTCTTCTTCCTGAGGGCTCGCAGCGCGAATCCACCATCGCGCAGCTGTCGCGCCTGCTCGACTCG
GAGGCCTCCCTGACCTCGTCGGCGCTGAAGCAGAACAACCTGTCGCTGCTGCGCGAGAAGCTGTCGTCGCACAGG
CGCGACCTCGGCCGCCTCCGCGGCGCCCTGCAGCAGGCCCGCGACCGGGCCAACCTGTTGACCAACGTCCGGTCC
GACATCGACCAGTACCGCGCCAACAACCCCGAGGCGGCCGAGGCCGAGTACATGCTCAACGAGCGCAACCGCATC
GACAACAGCCACAGCATGGCCGACAGCGTGCTGAGCCAGGCCTACGCCGTCAACGACAGCTTCAACCTCCAGAGG
GAGACGCTGGCCAGCATCAACCGCAGGATCACCTTGGCCGCGAGCCAGGTGCCCGGCATCAACAGCCTCATCGGC
AGGATATCGGCCAAGAAGCGGAGGGACGGCATCATCATGGGCTGCTTCATCGCCACCTGCTTCCTCGTCTTCTGG
TGGTTCATGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail