Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4226
Gene name
LocationContig_2178:363..1034
Strand+
Gene length (bp)671
Transcript length (bp)423
Coding sequence length (bp)423
Protein length (aa) 141

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 10 133 2.0E-24
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 10 133 4.0E-24
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 10 133 2.0E-23
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 4 133 4.0E-23
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 5 133 5.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 10 133 2.0E-24
sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 10 133 4.0E-24
sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 10 133 2.0E-23
sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 4 133 4.0E-23
sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 5 133 5.0E-23
sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 5 133 7.0E-23
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 11 133 9.0E-22
sp|Q5Z880|HRD1_ORYSJ ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Oryza sativa subsp. japonica GN=HRD1 PE=2 SV=1 4 133 3.0E-21
sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 11 133 4.0E-21
sp|Q9LW77|HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana GN=HRD1A PE=2 SV=1 4 133 3.0E-20
sp|Q6NPT7|HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana GN=HRD1B PE=2 SV=1 4 133 4.0E-19
sp|O74757|HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrd1 PE=1 SV=1 30 132 7.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 41 63 22
3 100 122 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4226
MPKMRLAWYTGVSTALAAAVVMSAFHQRDNFYSAMVYLAQSNLCLLALVNFSLLLYSSFIYGLTRVCYGTLRAVE
VEQLTERAWFAITETCLAMTIFREEIGAWFLVMFTALVTGKVWGWIGDGRVEFLEQQPPPNPTLT*
Coding >Hirsu2|4226
ATGCCCAAAATGCGACTTGCCTGGTACACTGGGGTCTCGACGGCCCTAGCGGCCGCAGTCGTCATGTCCGCTTTC
CATCAGCGCGATAACTTTTATTCGGCCATGGTCTATCTCGCACAGAGTAATTTGTGTTTGCTGGCACTGGTGAAT
TTCTCTCTTCTGCTTTATAGCAGCTTCATCTACGGCTTAACACGTGTCTGCTACGGTACTCTGCGAGCAGTCGAG
GTCGAACAGCTCACCGAGCGAGCCTGGTTTGCCATCACGGAAACCTGCCTGGCCATGACCATCTTTCGGGAAGAG
ATAGGAGCCTGGTTTTTGGTCATGTTTACCGCTCTCGTGACTGGCAAAGTCTGGGGCTGGATTGGCGACGGACGA
GTCGAGTTCCTCGAGCAGCAACCGCCGCCAAACCCCACACTAACGTGA
Transcript >Hirsu2|4226
ATGCCCAAAATGCGACTTGCCTGGTACACTGGGGTCTCGACGGCCCTAGCGGCCGCAGTCGTCATGTCCGCTTTC
CATCAGCGCGATAACTTTTATTCGGCCATGGTCTATCTCGCACAGAGTAATTTGTGTTTGCTGGCACTGGTGAAT
TTCTCTCTTCTGCTTTATAGCAGCTTCATCTACGGCTTAACACGTGTCTGCTACGGTACTCTGCGAGCAGTCGAG
GTCGAACAGCTCACCGAGCGAGCCTGGTTTGCCATCACGGAAACCTGCCTGGCCATGACCATCTTTCGGGAAGAG
ATAGGAGCCTGGTTTTTGGTCATGTTTACCGCTCTCGTGACTGGCAAAGTCTGGGGCTGGATTGGCGACGGACGA
GTCGAGTTCCTCGAGCAGCAACCGCCGCCAAACCCCACACTAACGTGA
Gene >Hirsu2|4226
ATGCCCAAAATGCGACTTGCCTGGTACACTGGGGTATGTTTGCTCCCGACACAGACAAAATCTCGAGTTCTTCGC
TCGGTTGATTTTGAAAACATGTCAGGTTGACAGAAGCTCCAGGTCTCGACGGCCCTAGCGGCCGCAGTCGTCATG
TCCGCTTTCCATCAGCGCGATAACTTTTATTCGGCCATGGTCTATCTCGCACAGAGTAATTTGTGTTTGCTGGTA
TCATTTCACTGCTTTTTCTTCCTACGGGGTCAGATGCCCGTCTCCTTTCATACACGAGCTGACTGGTGTACGACT
ACCCTCCTAGGCACTGGTGAATTTCTCTCTTCTGCTTTATAGCAGCTTCATCTACGGCTTAACACGTGTCTGCTA
CGGTACTCTGCGAGCAGTCGAGGTCGAACAGCTCACCGAGCGAGCCTGGTTTGCCATCACGGAAACCTGCCTGGC
CATGACCATCTTTCGGGAAGAGATAGGAGCCTGGTTTTTGGTCATGTTTACCGCTCTCGTGACTGGCAAAGTCTG
GGGCTGGATTGGCGACGGACGAGTCGAGTTCCTCGAGCAGCAACCGCCGCCAAACCCCACACTGTTCCACATTCG
CCTCAGCGTCTCCCTTGCCTTGAGCTTTTTGTACGACATGTGGATACTCCGGTATGCGGTTCAGAACGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail