Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4224
Gene name
LocationContig_2175:571..3360
Strand-
Gene length (bp)2789
Transcript length (bp)2679
Coding sequence length (bp)2679
Protein length (aa) 893

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02141 DENN DENN (AEX-3) domain 7.1E-59 183 379
PF03456 uDENN uDENN domain 5.6E-14 10 75
PF03455 dDENN dDENN domain 3.1E-14 718 767

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Q7|DENN_SCHPO DENN domain-containing protein C297.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC297.05 PE=1 SV=1 2 779 2.0E-112
sp|Q6ZUT9|DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens GN=DENND5B PE=1 SV=2 3 460 4.0E-18
sp|Q6IQ26|DEN5A_HUMAN DENN domain-containing protein 5A OS=Homo sapiens GN=DENND5A PE=1 SV=2 3 415 2.0E-17
sp|Q6PAL8|DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus GN=Dennd5a PE=1 SV=1 3 415 3.0E-17
sp|O95248|MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens GN=SBF1 PE=1 SV=3 233 421 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Q7|DENN_SCHPO DENN domain-containing protein C297.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC297.05 PE=1 SV=1 2 779 2.0E-112
sp|Q6ZUT9|DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens GN=DENND5B PE=1 SV=2 3 460 4.0E-18
sp|Q6IQ26|DEN5A_HUMAN DENN domain-containing protein 5A OS=Homo sapiens GN=DENND5A PE=1 SV=2 3 415 2.0E-17
sp|Q6PAL8|DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus GN=Dennd5a PE=1 SV=1 3 415 3.0E-17
sp|O95248|MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens GN=SBF1 PE=1 SV=3 233 421 1.0E-16
sp|Q6ZPE2|MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus GN=Sbf1 PE=1 SV=2 233 421 3.0E-16
sp|Q91VV4|DEN2D_MOUSE DENN domain-containing protein 2D OS=Mus musculus GN=Dennd2d PE=1 SV=1 279 382 5.0E-16
sp|Q9H6A0|DEN2D_HUMAN DENN domain-containing protein 2D OS=Homo sapiens GN=DENND2D PE=1 SV=2 279 382 7.0E-16
sp|Q8RXA7|SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 228 424 3.0E-15
sp|Q86WG5|MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens GN=SBF2 PE=1 SV=1 233 421 3.0E-15
sp|Q6NXD8|DEN5B_DANRE DENN domain-containing protein 5B OS=Danio rerio GN=dennd5b PE=2 SV=2 234 403 8.0E-15
sp|A2RSQ0|DEN5B_MOUSE DENN domain-containing protein 5B OS=Mus musculus GN=Dennd5b PE=1 SV=2 232 426 3.0E-14
sp|Q6NTN5|MTMRD_XENLA Myotubularin-related protein 13 OS=Xenopus laevis GN=sbf2 PE=2 SV=1 233 394 4.0E-14
sp|P78524|ST5_HUMAN Suppression of tumorigenicity 5 protein OS=Homo sapiens GN=ST5 PE=1 SV=3 279 380 8.0E-14
sp|Q924W7|ST5_MOUSE Suppression of tumorigenicity 5 protein OS=Mus musculus GN=St5 PE=1 SV=1 279 380 9.0E-14
sp|Q7Z401|MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens GN=DENND4A PE=1 SV=2 283 404 1.0E-13
sp|Q5VZ89|DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens GN=DENND4C PE=1 SV=2 232 410 3.0E-13
sp|Q8IV53|DEN1C_HUMAN DENN domain-containing protein 1C OS=Homo sapiens GN=DENND1C PE=1 SV=1 280 385 1.0E-12
sp|Q9ULE3|DEN2A_HUMAN DENN domain-containing protein 2A OS=Homo sapiens GN=DENND2A PE=2 SV=4 279 354 3.0E-12
sp|Q8C4S8|DEN2A_MOUSE DENN domain-containing protein 2A OS=Mus musculus GN=Dennd2a PE=1 SV=1 279 354 3.0E-12
sp|Q68D51|DEN2C_HUMAN DENN domain-containing protein 2C OS=Homo sapiens GN=DENND2C PE=1 SV=2 279 404 4.0E-12
sp|Q6P3S1|DEN1B_HUMAN DENN domain-containing protein 1B OS=Homo sapiens GN=DENND1B PE=1 SV=1 273 384 6.0E-12
sp|Q8CFK6|DEN1C_MOUSE DENN domain-containing protein 1C OS=Mus musculus GN=Dennd1c PE=1 SV=1 280 383 8.0E-12
sp|O75064|DEN4B_HUMAN DENN domain-containing protein 4B OS=Homo sapiens GN=DENND4B PE=1 SV=4 284 403 1.0E-11
sp|Q3U1T9|DEN1B_MOUSE DENN domain-containing protein 1B OS=Mus musculus GN=Dennd1b PE=1 SV=2 273 384 2.0E-11
sp|Q8K382|DEN1A_MOUSE DENN domain-containing protein 1A OS=Mus musculus GN=Dennd1a PE=1 SV=2 270 383 3.0E-11
sp|Q8TEH3|DEN1A_HUMAN DENN domain-containing protein 1A OS=Homo sapiens GN=DENND1A PE=1 SV=2 273 383 3.0E-11
sp|A6H8H2|DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus GN=Dennd4c PE=1 SV=1 232 382 5.0E-11
sp|Q6P9P8|DEN2C_MOUSE DENN domain-containing protein 2C OS=Mus musculus GN=Dennd2c PE=1 SV=1 279 404 1.0E-10
sp|Q68F67|DEN1A_XENLA DENN domain-containing protein 1A OS=Xenopus laevis GN=dennd1a PE=2 SV=1 270 384 2.0E-10
sp|Q3U1Y4|DEN4B_MOUSE DENN domain-containing protein 4B OS=Mus musculus GN=Dennd4b PE=1 SV=2 284 382 3.0E-10
sp|A2RT67|DEND3_MOUSE DENN domain-containing protein 3 OS=Mus musculus GN=Dennd3 PE=1 SV=2 279 402 9.0E-08
sp|A2RUS2|DEND3_HUMAN DENN domain-containing protein 3 OS=Homo sapiens GN=DENND3 PE=1 SV=2 291 382 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4224
MHPLKRRFEPVLLDRYPPKTATDEIPKRGKFPDYVPMFAFPNDIQIVSSDDRPRSTWHGFTMTSEDNSKLYGITI
IIWTALTADVAEDIETKCELWRQNHMSNEERELAASLGVRLAGERSHLSHLLSKLPTIPSGSAARDRLEDEIGTV
EEKIALMTDMLRPLRHGAASKIEGLTAGESGLWIPRAYGVLGRDPANMSFWKEWLRSILIPMTDGSVLRVPPSSP
KVGRWQPLERYVVNLCTEAFSPLGSKTQVELGVRELRLYSRKEGSNELPGSRTVDLYALFRSLSLENIVALFEYA
MSESRIIFLSSHTSMLHLACHALASLLYPFKWASIFIPVLPARLISALEAPCPYIVGVERRYERIELPEDDYVLV
DLDKDTIDATSQPHRLPRPHRRKLMSLLQVAAPHMLRYGVAVGPPPYAIESFPYDSFSSENGSVLSPIPPPATLG
KWVSQNSSSFGEPDPPDQVHPPVFNAFTVSAVDNGKSDRPGTSKSSRTSPQSSVSPASTNFPPMPTTPLSRSDSG
FALTATLREKRSGHFGEEKCRRSSSFGLDKFQSAHRSGVPFLNGHQPNASISGISVDSHSSFGGGYAPSTYAQST
LAASTIMPNMQIQPVRNTETTVWVEGHCFDLNPKDAGSLCAICEERPDIDGIYQCAACKACAHSRCLGQVSLVCP
EAFHADRVRAAFVRCMASLLYTYRKHLGRPSKQQKSNGQLYAFDMDGFIKSLPYDQQEYAAVLRDTQAFNEFIHQ
RETLAATDPPVRLFDEIIMAKKARGRPGLPSGLSRLSTIRASHGASTNAWNVAPPARSAASKTPGYLTDTSDHIW
RTASVPLPKGNFPGEYRSVVTRIPSRLDRALMREPRAIQGVPRVEQRGTRGLVRKQVPSMLGTTPPA*
Coding >Hirsu2|4224
ATGCACCCGCTCAAGCGACGATTCGAGCCCGTGCTGCTCGACCGATACCCGCCCAAGACGGCCACCGACGAGATC
CCTAAGCGAGGCAAATTCCCCGACTACGTCCCCATGTTCGCCTTCCCCAACGACATCCAGATCGTCTCGTCCGAC
GACCGGCCGCGCTCGACCTGGCACGGCTTCACCATGACCTCGGAGGACAACTCCAAACTGTACGGCATCACCATC
ATCATATGGACGGCCCTTACGGCCGACGTGGCCGAGGACATCGAGACCAAGTGCGAGCTGTGGCGCCAGAACCAC
ATGTCCAACGAGGAGCGGGAGCTGGCGGCGAGCCTGGGGGTGCGCCTGGCGGGCGAACGCTCTCACCTCTCCCAC
CTGCTGTCCAAGCTCCCCACGATACCTTCGGGCTCCGCGGCCCGCGACAGACTCGAGGACGAGATCGGCACCGTC
GAGGAGAAGATCGCCCTGATGACGGACATGCTGCGGCCCCTGCGCCACGGCGCGGCCTCCAAGATCGAGGGGCTC
ACGGCCGGCGAGAGCGGGCTCTGGATACCGCGTGCGTACGGCGTCCTGGGGAGAGACCCGGCCAACATGTCCTTC
TGGAAGGAATGGCTGAGGTCCATCCTGATCCCCATGACGGACGGGAGCGTCCTGCGCGTCCCGCCCAGCTCCCCC
AAGGTCGGGCGTTGGCAGCCCCTGGAACGCTACGTCGTCAACCTGTGCACCGAGGCCTTCAGCCCCCTCGGCTCC
AAGACGCAAGTCGAGCTCGGCGTGCGGGAGCTGAGGCTTTACTCGCGCAAGGAGGGCAGCAACGAGCTGCCCGGG
TCCAGGACGGTCGACCTCTACGCTCTCTTTCGGTCTCTCTCCCTCGAGAACATCGTCGCGCTCTTCGAGTACGCC
ATGTCCGAGTCCAGGATCATCTTCCTCTCGTCCCACACCAGCATGCTGCATCTTGCCTGCCATGCGCTGGCCAGC
CTGCTCTACCCCTTCAAGTGGGCGAGCATCTTCATCCCCGTCCTGCCCGCGAGGCTGATCTCCGCCCTCGAGGCC
CCGTGCCCCTACATCGTCGGCGTCGAGCGCCGCTACGAGAGGATCGAGCTGCCCGAGGACGACTACGTCCTCGTC
GACCTGGACAAGGACACCATCGACGCCACCTCCCAGCCCCATCGGCTCCCCAGGCCACATCGGCGGAAGCTCATG
TCGCTGCTGCAAGTGGCGGCTCCCCACATGTTGCGCTACGGCGTGGCCGTCGGCCCCCCTCCATATGCGATCGAG
TCCTTTCCCTACGATTCCTTCTCGTCCGAGAACGGCTCGGTCTTGTCGCCGATCCCCCCCCCGGCCACCCTGGGC
AAATGGGTCTCCCAGAACTCGTCGAGCTTTGGCGAGCCGGACCCCCCGGATCAGGTCCACCCCCCGGTCTTCAAC
GCCTTCACCGTCTCCGCCGTGGACAACGGGAAGTCGGACCGGCCCGGGACGAGCAAGTCGAGCCGGACCAGTCCC
CAGTCGTCCGTCTCCCCAGCATCCACCAACTTCCCGCCCATGCCCACCACGCCGCTGTCGCGTAGCGACTCCGGC
TTCGCCCTGACGGCCACGCTGCGCGAGAAGCGCTCCGGGCACTTCGGCGAAGAGAAGTGCCGCCGCAGCTCGTCA
TTTGGCCTGGACAAGTTTCAGTCGGCGCACCGGTCGGGCGTGCCCTTCCTCAACGGTCACCAGCCCAACGCCTCC
ATCTCGGGCATCTCCGTCGACTCGCACTCCTCCTTCGGCGGAGGCTACGCGCCGTCTACGTATGCGCAGTCGACC
CTGGCCGCCTCGACCATCATGCCCAACATGCAAATCCAGCCCGTGCGGAACACGGAGACGACGGTCTGGGTGGAG
GGCCACTGCTTCGACCTCAACCCCAAGGACGCGGGCTCGCTTTGCGCCATCTGCGAGGAGCGACCGGACATTGAC
GGCATATACCAGTGCGCGGCCTGCAAGGCCTGCGCCCACAGCAGGTGCCTGGGCCAGGTGTCCCTCGTCTGCCCG
GAGGCTTTCCACGCGGACCGGGTCAGGGCCGCGTTCGTGCGCTGCATGGCCAGCCTGCTGTACACGTACAGGAAA
CACCTCGGCCGGCCCTCGAAGCAGCAGAAGAGCAACGGTCAGCTGTACGCGTTCGACATGGACGGCTTCATCAAG
AGCCTGCCGTACGACCAACAGGAGTACGCCGCGGTGCTGCGGGACACGCAGGCTTTCAACGAGTTCATACACCAA
CGCGAAACATTGGCGGCGACGGACCCGCCGGTTCGACTTTTCGACGAGATCATCATGGCGAAGAAGGCCCGCGGC
CGCCCGGGCTTGCCCTCCGGCCTGTCGCGCCTCTCCACCATCCGCGCGTCTCACGGTGCGTCGACCAACGCCTGG
AACGTGGCGCCGCCCGCACGAAGCGCCGCCAGCAAGACGCCCGGCTACCTCACGGACACGTCGGACCACATCTGG
CGAACGGCATCGGTTCCCCTGCCCAAGGGGAACTTTCCCGGCGAGTACCGCTCGGTCGTGACGCGGATACCGTCC
CGGCTCGACCGTGCGCTGATGCGCGAGCCGCGCGCCATCCAAGGGGTTCCCCGCGTGGAGCAGCGAGGCACGCGG
GGCCTCGTCCGCAAGCAGGTGCCCAGCATGCTCGGCACGACGCCGCCGGCGTGA
Transcript >Hirsu2|4224
ATGCACCCGCTCAAGCGACGATTCGAGCCCGTGCTGCTCGACCGATACCCGCCCAAGACGGCCACCGACGAGATC
CCTAAGCGAGGCAAATTCCCCGACTACGTCCCCATGTTCGCCTTCCCCAACGACATCCAGATCGTCTCGTCCGAC
GACCGGCCGCGCTCGACCTGGCACGGCTTCACCATGACCTCGGAGGACAACTCCAAACTGTACGGCATCACCATC
ATCATATGGACGGCCCTTACGGCCGACGTGGCCGAGGACATCGAGACCAAGTGCGAGCTGTGGCGCCAGAACCAC
ATGTCCAACGAGGAGCGGGAGCTGGCGGCGAGCCTGGGGGTGCGCCTGGCGGGCGAACGCTCTCACCTCTCCCAC
CTGCTGTCCAAGCTCCCCACGATACCTTCGGGCTCCGCGGCCCGCGACAGACTCGAGGACGAGATCGGCACCGTC
GAGGAGAAGATCGCCCTGATGACGGACATGCTGCGGCCCCTGCGCCACGGCGCGGCCTCCAAGATCGAGGGGCTC
ACGGCCGGCGAGAGCGGGCTCTGGATACCGCGTGCGTACGGCGTCCTGGGGAGAGACCCGGCCAACATGTCCTTC
TGGAAGGAATGGCTGAGGTCCATCCTGATCCCCATGACGGACGGGAGCGTCCTGCGCGTCCCGCCCAGCTCCCCC
AAGGTCGGGCGTTGGCAGCCCCTGGAACGCTACGTCGTCAACCTGTGCACCGAGGCCTTCAGCCCCCTCGGCTCC
AAGACGCAAGTCGAGCTCGGCGTGCGGGAGCTGAGGCTTTACTCGCGCAAGGAGGGCAGCAACGAGCTGCCCGGG
TCCAGGACGGTCGACCTCTACGCTCTCTTTCGGTCTCTCTCCCTCGAGAACATCGTCGCGCTCTTCGAGTACGCC
ATGTCCGAGTCCAGGATCATCTTCCTCTCGTCCCACACCAGCATGCTGCATCTTGCCTGCCATGCGCTGGCCAGC
CTGCTCTACCCCTTCAAGTGGGCGAGCATCTTCATCCCCGTCCTGCCCGCGAGGCTGATCTCCGCCCTCGAGGCC
CCGTGCCCCTACATCGTCGGCGTCGAGCGCCGCTACGAGAGGATCGAGCTGCCCGAGGACGACTACGTCCTCGTC
GACCTGGACAAGGACACCATCGACGCCACCTCCCAGCCCCATCGGCTCCCCAGGCCACATCGGCGGAAGCTCATG
TCGCTGCTGCAAGTGGCGGCTCCCCACATGTTGCGCTACGGCGTGGCCGTCGGCCCCCCTCCATATGCGATCGAG
TCCTTTCCCTACGATTCCTTCTCGTCCGAGAACGGCTCGGTCTTGTCGCCGATCCCCCCCCCGGCCACCCTGGGC
AAATGGGTCTCCCAGAACTCGTCGAGCTTTGGCGAGCCGGACCCCCCGGATCAGGTCCACCCCCCGGTCTTCAAC
GCCTTCACCGTCTCCGCCGTGGACAACGGGAAGTCGGACCGGCCCGGGACGAGCAAGTCGAGCCGGACCAGTCCC
CAGTCGTCCGTCTCCCCAGCATCCACCAACTTCCCGCCCATGCCCACCACGCCGCTGTCGCGTAGCGACTCCGGC
TTCGCCCTGACGGCCACGCTGCGCGAGAAGCGCTCCGGGCACTTCGGCGAAGAGAAGTGCCGCCGCAGCTCGTCA
TTTGGCCTGGACAAGTTTCAGTCGGCGCACCGGTCGGGCGTGCCCTTCCTCAACGGTCACCAGCCCAACGCCTCC
ATCTCGGGCATCTCCGTCGACTCGCACTCCTCCTTCGGCGGAGGCTACGCGCCGTCTACGTATGCGCAGTCGACC
CTGGCCGCCTCGACCATCATGCCCAACATGCAAATCCAGCCCGTGCGGAACACGGAGACGACGGTCTGGGTGGAG
GGCCACTGCTTCGACCTCAACCCCAAGGACGCGGGCTCGCTTTGCGCCATCTGCGAGGAGCGACCGGACATTGAC
GGCATATACCAGTGCGCGGCCTGCAAGGCCTGCGCCCACAGCAGGTGCCTGGGCCAGGTGTCCCTCGTCTGCCCG
GAGGCTTTCCACGCGGACCGGGTCAGGGCCGCGTTCGTGCGCTGCATGGCCAGCCTGCTGTACACGTACAGGAAA
CACCTCGGCCGGCCCTCGAAGCAGCAGAAGAGCAACGGTCAGCTGTACGCGTTCGACATGGACGGCTTCATCAAG
AGCCTGCCGTACGACCAACAGGAGTACGCCGCGGTGCTGCGGGACACGCAGGCTTTCAACGAGTTCATACACCAA
CGCGAAACATTGGCGGCGACGGACCCGCCGGTTCGACTTTTCGACGAGATCATCATGGCGAAGAAGGCCCGCGGC
CGCCCGGGCTTGCCCTCCGGCCTGTCGCGCCTCTCCACCATCCGCGCGTCTCACGGTGCGTCGACCAACGCCTGG
AACGTGGCGCCGCCCGCACGAAGCGCCGCCAGCAAGACGCCCGGCTACCTCACGGACACGTCGGACCACATCTGG
CGAACGGCATCGGTTCCCCTGCCCAAGGGGAACTTTCCCGGCGAGTACCGCTCGGTCGTGACGCGGATACCGTCC
CGGCTCGACCGTGCGCTGATGCGCGAGCCGCGCGCCATCCAAGGGGTTCCCCGCGTGGAGCAGCGAGGCACGCGG
GGCCTCGTCCGCAAGCAGGTGCCCAGCATGCTCGGCACGACGCCGCCGGCGTGA
Gene >Hirsu2|4224
ATGCACCCGCTCAAGCGACGATTCGAGCCCGTGCTGCTCGACCGATACCCGCCCAAGACGGCCACCGACGAGATC
CCTAAGCGAGGCAAATTCCCCGACTACGTCCCCATGTTCGCCTTCCCCAACGACATCCAGATCGTCTCGTCCGAC
GACCGGCCGCGCTCGACCTGGCACGGCTTCACCATGACCTCGGAGGACAACTCCAAACTGTACGGCATCACCATC
ATCATATGGACGGCCCTTACGGCCGACGTGGCCGAGGACATCGAGACCAAGTGCGAGCTGTGGCGCCAGAACCAC
ATGTCCAACGAGGAGCGGGAGCTGGCGGCGAGCCTGGGGGTGCGCCTGGCGGGCGAACGCTCTCACCTCTCCCAC
CTGCTGTCCAAGCTCCCCACGATACCTTCGGGCTCCGCGGCCCGCGACAGACTCGAGGACGAGATCGGCACCGTC
GAGGAGAAGATCGCCCTGATGACGGACATGCTGCGGCCCCTGCGCCACGGCGCGGCCTCCAAGATCGAGGGGCTC
ACGGCCGGCGAGAGCGGGCTCTGGATACCGCGTGCGTACGGCGTCCTGGGGAGAGACCCGGCCAACATGTCCTTC
TGGAAGGAATGGCTGAGGTCCATCCTGATCCCCATGACGGACGGGAGCGTCCTGCGCGTCCCGCCCAGCTCCCCC
AAGGTCGGGCGTTGGCAGCCCCTGGAACGCTACGTCGTCAACCTGTGCACCGAGGCCTTCAGCCCCCTCGGCTCC
AAGACGCAAGTCGAGCTCGGCGTGCGGGAGCTGAGGCTTTACTCGCGCAAGGAGGGCAGCAACGAGCTGCCCGGG
TCCAGGACGGTCGACCTCTACGCTCTCTTTCGGTCTCTCTCCCTCGAGAACATCGTCGCGCTCTTCGAGTACGCC
ATGTCCGAGTCCAGGATCATCTTCCTCTCGTCCCACACCAGCATGCTGCATCTTGCCTGCCATGCGCTGGCCAGC
CTGCTCTACCCCTTCAAGTGGGCGAGCATCTTCATCCCCGTCCTGCCCGCGAGGCTGATCTCCGCCCTCGAGGCC
CCGTGCCCCTACATCGTCGGCGTCGAGCGCCGCTACGAGAGGATCGAGCTGCCCGAGGACGACTACGTCCTCGTC
GACCTGGACAAGGACACCATCGACGCCACCTCCCAGCCCCATCGGCTCCCCAGGCCACATCGGCGGAAGCTCATG
TCGCTGCTGCAAGTGGCGGCTCCCCACATGTTGCGCTACGGCGTGGCCGTCGGCCCCCCTCCATATGCGATCGAG
TCCTTTCCCTACGATTCCTTCTCGTCCGAGAACGGCTCGGTCTTGTCGCCGATCCCCCCCCCGGCCACCCTGGGC
AAATGGGTCTCCCAGAACTCGTCGAGCTTTGGCGAGCCGGACCCCCCGGATCAGGTCCACCCCCCGGTCTTCAAC
GCCTTCACCGTCTCCGCCGTGGACAACGGGAAGTCGGACCGGCCCGGGACGAGCAAGTCGAGCCGGACCAGTCCC
CAGTCGTCCGTCTCCCCAGCATCCACCAACTTCCCGCCCATGCCCACCACGCCGCTGTCGCGTAGCGACTCCGGC
TTCGCCCTGACGGCCACGCTGCGCGAGAAGCGCTCCGGGCACTTCGGCGAAGAGAAGTGCCGCCGCAGCTCGTCA
TTTGGCCTGGACAAGTTTCAGTCGGCGCACCGGTCGGGCGTGCCCTTCCTCAACGGTCACCAGCCCAACGCCTCC
ATCTCGGGCATCTCCGTCGACTCGCACTCCTCCTTCGGCGGAGGCTACGCGCCGTCTACGTATGCGCAGTCGACC
CTGGCCGCCTCGACCATCATGCCCAACATGCAAATCCAGCCCGTGCGGAACACGGAGACGACGGTCTGGGTGGAG
GGCCACTGCTTCGACCTCAACCCCAAGGACGCGGGCTCGCTTTGCGCCATCTGCGAGGAGCGACCGGACATTGAC
GGCATATACCAGTGCGCGGCCTGCAAGGCCTGCGCCCACAGCAGGTGCCTGGGCCAGGTGTCCCTCGTCTGCCCG
GAGGCTTTCCACGCGGACCGGGTCAGGGCCGCGTTCGTGCGCTGCATGGCCAGCCTGCTGTACACGTACAGGAAA
CACCTCGGCCGGCCCTCGAAGCAGCAGAAGAGCAACGGTCAGCTGTACGCGTTCGACATGGACGGCTTCATCAAG
AGCCTGCCGTACGACCAACAGGAGTACGCCGCGGTGCTGCGGGACACGCAGGGTACGTATCCGAGCGTCTCGTTT
TGTTTTGACCGTCCAGTCTCGGAGCATGTTGTGCCGCGACCTGTTCGGTACGACAAGGTTGGCACGCTAACGCCA
CGCCCTCACTAGCTTTCAACGAGTTCATACACCAACGCGAAACATTGGCGGCGACGGACCCGCCGGTTCGACTTT
TCGACGAGATCATCATGGCGAAGAAGGCCCGCGGCCGCCCGGGCTTGCCCTCCGGCCTGTCGCGCCTCTCCACCA
TCCGCGCGTCTCACGGTGCGTCGACCAACGCCTGGAACGTGGCGCCGCCCGCACGAAGCGCCGCCAGCAAGACGC
CCGGCTACCTCACGGACACGTCGGACCACATCTGGCGAACGGCATCGGTTCCCCTGCCCAAGGGGAACTTTCCCG
GCGAGTACCGCTCGGTCGTGACGCGGATACCGTCCCGGCTCGACCGTGCGCTGATGCGCGAGCCGCGCGCCATCC
AAGGGGTTCCCCGCGTGGAGCAGCGAGGCACGCGGGGCCTCGTCCGCAAGCAGGTGCCCAGCATGCTCGGCACGA
CGCCGCCGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail