Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4224
Gene name
LocationContig_2175:571..3360
Strand-
Gene length (bp)2789
Transcript length (bp)2679
Coding sequence length (bp)2679
Protein length (aa) 893

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02141 DENN DENN (AEX-3) domain 1.4E-59 183 380
PF03456 uDENN uDENN domain 6.0E-16 10 76
PF03455 dDENN dDENN domain 1.4E-15 718 767

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Q7|DENN_SCHPO DENN domain-containing protein C297.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC297.05 PE=1 SV=1 2 779 2.0E-112
sp|Q6ZUT9|DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens GN=DENND5B PE=1 SV=2 3 460 4.0E-18
sp|Q6IQ26|DEN5A_HUMAN DENN domain-containing protein 5A OS=Homo sapiens GN=DENND5A PE=1 SV=2 3 415 2.0E-17
sp|Q6PAL8|DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus GN=Dennd5a PE=1 SV=1 3 415 3.0E-17
sp|O95248|MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens GN=SBF1 PE=1 SV=3 233 421 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7Q7|DENN_SCHPO DENN domain-containing protein C297.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC297.05 PE=1 SV=1 2 779 2.0E-112
sp|Q6ZUT9|DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens GN=DENND5B PE=1 SV=2 3 460 4.0E-18
sp|Q6IQ26|DEN5A_HUMAN DENN domain-containing protein 5A OS=Homo sapiens GN=DENND5A PE=1 SV=2 3 415 2.0E-17
sp|Q6PAL8|DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus GN=Dennd5a PE=1 SV=1 3 415 3.0E-17
sp|O95248|MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens GN=SBF1 PE=1 SV=3 233 421 1.0E-16
sp|Q6ZPE2|MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus GN=Sbf1 PE=1 SV=2 233 421 3.0E-16
sp|Q91VV4|DEN2D_MOUSE DENN domain-containing protein 2D OS=Mus musculus GN=Dennd2d PE=1 SV=1 279 382 5.0E-16
sp|Q9H6A0|DEN2D_HUMAN DENN domain-containing protein 2D OS=Homo sapiens GN=DENND2D PE=1 SV=2 279 382 7.0E-16
sp|Q8RXA7|SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 228 424 3.0E-15
sp|Q86WG5|MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens GN=SBF2 PE=1 SV=1 233 421 3.0E-15
sp|Q6NXD8|DEN5B_DANRE DENN domain-containing protein 5B OS=Danio rerio GN=dennd5b PE=2 SV=2 234 403 8.0E-15
sp|A2RSQ0|DEN5B_MOUSE DENN domain-containing protein 5B OS=Mus musculus GN=Dennd5b PE=1 SV=2 232 426 3.0E-14
sp|Q6NTN5|MTMRD_XENLA Myotubularin-related protein 13 OS=Xenopus laevis GN=sbf2 PE=2 SV=1 233 394 4.0E-14
sp|P78524|ST5_HUMAN Suppression of tumorigenicity 5 protein OS=Homo sapiens GN=ST5 PE=1 SV=3 279 380 8.0E-14
sp|Q924W7|ST5_MOUSE Suppression of tumorigenicity 5 protein OS=Mus musculus GN=St5 PE=1 SV=1 279 380 9.0E-14
sp|Q7Z401|MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens GN=DENND4A PE=1 SV=2 283 404 1.0E-13
sp|Q5VZ89|DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens GN=DENND4C PE=1 SV=2 232 410 3.0E-13
sp|Q8IV53|DEN1C_HUMAN DENN domain-containing protein 1C OS=Homo sapiens GN=DENND1C PE=1 SV=1 280 385 1.0E-12
sp|Q9ULE3|DEN2A_HUMAN DENN domain-containing protein 2A OS=Homo sapiens GN=DENND2A PE=2 SV=4 279 354 3.0E-12
sp|Q8C4S8|DEN2A_MOUSE DENN domain-containing protein 2A OS=Mus musculus GN=Dennd2a PE=1 SV=1 279 354 3.0E-12
sp|Q68D51|DEN2C_HUMAN DENN domain-containing protein 2C OS=Homo sapiens GN=DENND2C PE=1 SV=2 279 404 4.0E-12
sp|Q6P3S1|DEN1B_HUMAN DENN domain-containing protein 1B OS=Homo sapiens GN=DENND1B PE=1 SV=1 273 384 6.0E-12
sp|Q8CFK6|DEN1C_MOUSE DENN domain-containing protein 1C OS=Mus musculus GN=Dennd1c PE=1 SV=1 280 383 8.0E-12
sp|O75064|DEN4B_HUMAN DENN domain-containing protein 4B OS=Homo sapiens GN=DENND4B PE=1 SV=4 284 403 1.0E-11
sp|Q3U1T9|DEN1B_MOUSE DENN domain-containing protein 1B OS=Mus musculus GN=Dennd1b PE=1 SV=2 273 384 2.0E-11
sp|Q8K382|DEN1A_MOUSE DENN domain-containing protein 1A OS=Mus musculus GN=Dennd1a PE=1 SV=2 270 383 3.0E-11
sp|Q8TEH3|DEN1A_HUMAN DENN domain-containing protein 1A OS=Homo sapiens GN=DENND1A PE=1 SV=2 273 383 3.0E-11
sp|A6H8H2|DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus GN=Dennd4c PE=1 SV=1 232 382 5.0E-11
sp|Q6P9P8|DEN2C_MOUSE DENN domain-containing protein 2C OS=Mus musculus GN=Dennd2c PE=1 SV=1 279 404 1.0E-10
sp|Q68F67|DEN1A_XENLA DENN domain-containing protein 1A OS=Xenopus laevis GN=dennd1a PE=2 SV=1 270 384 2.0E-10
sp|Q3U1Y4|DEN4B_MOUSE DENN domain-containing protein 4B OS=Mus musculus GN=Dennd4b PE=1 SV=2 284 382 3.0E-10
sp|A2RT67|DEND3_MOUSE DENN domain-containing protein 3 OS=Mus musculus GN=Dennd3 PE=1 SV=2 279 402 9.0E-08
sp|A2RUS2|DEND3_HUMAN DENN domain-containing protein 3 OS=Homo sapiens GN=DENND3 PE=1 SV=2 291 382 3.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.8054 0.3158 0.2275 0.211 0.0996 0.0413 0.0806 0.378 0.2849 0.0147

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2708
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4035
Ophiocordyceps australis map64 (Brazil) OphauB2|3253
Ophiocordyceps camponoti-floridani Ophcf2|06665
Ophiocordyceps camponoti-rufipedis Ophun1|6031
Ophiocordyceps kimflemingae Ophio5|6207
Ophiocordyceps subramaniannii Hirsu2|4224 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4224
MHPLKRRFEPVLLDRYPPKTATDEIPKRGKFPDYVPMFAFPNDIQIVSSDDRPRSTWHGFTMTSEDNSKLYGITI
IIWTALTADVAEDIETKCELWRQNHMSNEERELAASLGVRLAGERSHLSHLLSKLPTIPSGSAARDRLEDEIGTV
EEKIALMTDMLRPLRHGAASKIEGLTAGESGLWIPRAYGVLGRDPANMSFWKEWLRSILIPMTDGSVLRVPPSSP
KVGRWQPLERYVVNLCTEAFSPLGSKTQVELGVRELRLYSRKEGSNELPGSRTVDLYALFRSLSLENIVALFEYA
MSESRIIFLSSHTSMLHLACHALASLLYPFKWASIFIPVLPARLISALEAPCPYIVGVERRYERIELPEDDYVLV
DLDKDTIDATSQPHRLPRPHRRKLMSLLQVAAPHMLRYGVAVGPPPYAIESFPYDSFSSENGSVLSPIPPPATLG
KWVSQNSSSFGEPDPPDQVHPPVFNAFTVSAVDNGKSDRPGTSKSSRTSPQSSVSPASTNFPPMPTTPLSRSDSG
FALTATLREKRSGHFGEEKCRRSSSFGLDKFQSAHRSGVPFLNGHQPNASISGISVDSHSSFGGGYAPSTYAQST
LAASTIMPNMQIQPVRNTETTVWVEGHCFDLNPKDAGSLCAICEERPDIDGIYQCAACKACAHSRCLGQVSLVCP
EAFHADRVRAAFVRCMASLLYTYRKHLGRPSKQQKSNGQLYAFDMDGFIKSLPYDQQEYAAVLRDTQAFNEFIHQ
RETLAATDPPVRLFDEIIMAKKARGRPGLPSGLSRLSTIRASHGASTNAWNVAPPARSAASKTPGYLTDTSDHIW
RTASVPLPKGNFPGEYRSVVTRIPSRLDRALMREPRAIQGVPRVEQRGTRGLVRKQVPSMLGTTPPA*
Coding >Hirsu2|4224
ATGCACCCGCTCAAGCGACGATTCGAGCCCGTGCTGCTCGACCGATACCCGCCCAAGACGGCCACCGACGAGATC
CCTAAGCGAGGCAAATTCCCCGACTACGTCCCCATGTTCGCCTTCCCCAACGACATCCAGATCGTCTCGTCCGAC
GACCGGCCGCGCTCGACCTGGCACGGCTTCACCATGACCTCGGAGGACAACTCCAAACTGTACGGCATCACCATC
ATCATATGGACGGCCCTTACGGCCGACGTGGCCGAGGACATCGAGACCAAGTGCGAGCTGTGGCGCCAGAACCAC
ATGTCCAACGAGGAGCGGGAGCTGGCGGCGAGCCTGGGGGTGCGCCTGGCGGGCGAACGCTCTCACCTCTCCCAC
CTGCTGTCCAAGCTCCCCACGATACCTTCGGGCTCCGCGGCCCGCGACAGACTCGAGGACGAGATCGGCACCGTC
GAGGAGAAGATCGCCCTGATGACGGACATGCTGCGGCCCCTGCGCCACGGCGCGGCCTCCAAGATCGAGGGGCTC
ACGGCCGGCGAGAGCGGGCTCTGGATACCGCGTGCGTACGGCGTCCTGGGGAGAGACCCGGCCAACATGTCCTTC
TGGAAGGAATGGCTGAGGTCCATCCTGATCCCCATGACGGACGGGAGCGTCCTGCGCGTCCCGCCCAGCTCCCCC
AAGGTCGGGCGTTGGCAGCCCCTGGAACGCTACGTCGTCAACCTGTGCACCGAGGCCTTCAGCCCCCTCGGCTCC
AAGACGCAAGTCGAGCTCGGCGTGCGGGAGCTGAGGCTTTACTCGCGCAAGGAGGGCAGCAACGAGCTGCCCGGG
TCCAGGACGGTCGACCTCTACGCTCTCTTTCGGTCTCTCTCCCTCGAGAACATCGTCGCGCTCTTCGAGTACGCC
ATGTCCGAGTCCAGGATCATCTTCCTCTCGTCCCACACCAGCATGCTGCATCTTGCCTGCCATGCGCTGGCCAGC
CTGCTCTACCCCTTCAAGTGGGCGAGCATCTTCATCCCCGTCCTGCCCGCGAGGCTGATCTCCGCCCTCGAGGCC
CCGTGCCCCTACATCGTCGGCGTCGAGCGCCGCTACGAGAGGATCGAGCTGCCCGAGGACGACTACGTCCTCGTC
GACCTGGACAAGGACACCATCGACGCCACCTCCCAGCCCCATCGGCTCCCCAGGCCACATCGGCGGAAGCTCATG
TCGCTGCTGCAAGTGGCGGCTCCCCACATGTTGCGCTACGGCGTGGCCGTCGGCCCCCCTCCATATGCGATCGAG
TCCTTTCCCTACGATTCCTTCTCGTCCGAGAACGGCTCGGTCTTGTCGCCGATCCCCCCCCCGGCCACCCTGGGC
AAATGGGTCTCCCAGAACTCGTCGAGCTTTGGCGAGCCGGACCCCCCGGATCAGGTCCACCCCCCGGTCTTCAAC
GCCTTCACCGTCTCCGCCGTGGACAACGGGAAGTCGGACCGGCCCGGGACGAGCAAGTCGAGCCGGACCAGTCCC
CAGTCGTCCGTCTCCCCAGCATCCACCAACTTCCCGCCCATGCCCACCACGCCGCTGTCGCGTAGCGACTCCGGC
TTCGCCCTGACGGCCACGCTGCGCGAGAAGCGCTCCGGGCACTTCGGCGAAGAGAAGTGCCGCCGCAGCTCGTCA
TTTGGCCTGGACAAGTTTCAGTCGGCGCACCGGTCGGGCGTGCCCTTCCTCAACGGTCACCAGCCCAACGCCTCC
ATCTCGGGCATCTCCGTCGACTCGCACTCCTCCTTCGGCGGAGGCTACGCGCCGTCTACGTATGCGCAGTCGACC
CTGGCCGCCTCGACCATCATGCCCAACATGCAAATCCAGCCCGTGCGGAACACGGAGACGACGGTCTGGGTGGAG
GGCCACTGCTTCGACCTCAACCCCAAGGACGCGGGCTCGCTTTGCGCCATCTGCGAGGAGCGACCGGACATTGAC
GGCATATACCAGTGCGCGGCCTGCAAGGCCTGCGCCCACAGCAGGTGCCTGGGCCAGGTGTCCCTCGTCTGCCCG
GAGGCTTTCCACGCGGACCGGGTCAGGGCCGCGTTCGTGCGCTGCATGGCCAGCCTGCTGTACACGTACAGGAAA
CACCTCGGCCGGCCCTCGAAGCAGCAGAAGAGCAACGGTCAGCTGTACGCGTTCGACATGGACGGCTTCATCAAG
AGCCTGCCGTACGACCAACAGGAGTACGCCGCGGTGCTGCGGGACACGCAGGCTTTCAACGAGTTCATACACCAA
CGCGAAACATTGGCGGCGACGGACCCGCCGGTTCGACTTTTCGACGAGATCATCATGGCGAAGAAGGCCCGCGGC
CGCCCGGGCTTGCCCTCCGGCCTGTCGCGCCTCTCCACCATCCGCGCGTCTCACGGTGCGTCGACCAACGCCTGG
AACGTGGCGCCGCCCGCACGAAGCGCCGCCAGCAAGACGCCCGGCTACCTCACGGACACGTCGGACCACATCTGG
CGAACGGCATCGGTTCCCCTGCCCAAGGGGAACTTTCCCGGCGAGTACCGCTCGGTCGTGACGCGGATACCGTCC
CGGCTCGACCGTGCGCTGATGCGCGAGCCGCGCGCCATCCAAGGGGTTCCCCGCGTGGAGCAGCGAGGCACGCGG
GGCCTCGTCCGCAAGCAGGTGCCCAGCATGCTCGGCACGACGCCGCCGGCGTGA
Transcript >Hirsu2|4224
ATGCACCCGCTCAAGCGACGATTCGAGCCCGTGCTGCTCGACCGATACCCGCCCAAGACGGCCACCGACGAGATC
CCTAAGCGAGGCAAATTCCCCGACTACGTCCCCATGTTCGCCTTCCCCAACGACATCCAGATCGTCTCGTCCGAC
GACCGGCCGCGCTCGACCTGGCACGGCTTCACCATGACCTCGGAGGACAACTCCAAACTGTACGGCATCACCATC
ATCATATGGACGGCCCTTACGGCCGACGTGGCCGAGGACATCGAGACCAAGTGCGAGCTGTGGCGCCAGAACCAC
ATGTCCAACGAGGAGCGGGAGCTGGCGGCGAGCCTGGGGGTGCGCCTGGCGGGCGAACGCTCTCACCTCTCCCAC
CTGCTGTCCAAGCTCCCCACGATACCTTCGGGCTCCGCGGCCCGCGACAGACTCGAGGACGAGATCGGCACCGTC
GAGGAGAAGATCGCCCTGATGACGGACATGCTGCGGCCCCTGCGCCACGGCGCGGCCTCCAAGATCGAGGGGCTC
ACGGCCGGCGAGAGCGGGCTCTGGATACCGCGTGCGTACGGCGTCCTGGGGAGAGACCCGGCCAACATGTCCTTC
TGGAAGGAATGGCTGAGGTCCATCCTGATCCCCATGACGGACGGGAGCGTCCTGCGCGTCCCGCCCAGCTCCCCC
AAGGTCGGGCGTTGGCAGCCCCTGGAACGCTACGTCGTCAACCTGTGCACCGAGGCCTTCAGCCCCCTCGGCTCC
AAGACGCAAGTCGAGCTCGGCGTGCGGGAGCTGAGGCTTTACTCGCGCAAGGAGGGCAGCAACGAGCTGCCCGGG
TCCAGGACGGTCGACCTCTACGCTCTCTTTCGGTCTCTCTCCCTCGAGAACATCGTCGCGCTCTTCGAGTACGCC
ATGTCCGAGTCCAGGATCATCTTCCTCTCGTCCCACACCAGCATGCTGCATCTTGCCTGCCATGCGCTGGCCAGC
CTGCTCTACCCCTTCAAGTGGGCGAGCATCTTCATCCCCGTCCTGCCCGCGAGGCTGATCTCCGCCCTCGAGGCC
CCGTGCCCCTACATCGTCGGCGTCGAGCGCCGCTACGAGAGGATCGAGCTGCCCGAGGACGACTACGTCCTCGTC
GACCTGGACAAGGACACCATCGACGCCACCTCCCAGCCCCATCGGCTCCCCAGGCCACATCGGCGGAAGCTCATG
TCGCTGCTGCAAGTGGCGGCTCCCCACATGTTGCGCTACGGCGTGGCCGTCGGCCCCCCTCCATATGCGATCGAG
TCCTTTCCCTACGATTCCTTCTCGTCCGAGAACGGCTCGGTCTTGTCGCCGATCCCCCCCCCGGCCACCCTGGGC
AAATGGGTCTCCCAGAACTCGTCGAGCTTTGGCGAGCCGGACCCCCCGGATCAGGTCCACCCCCCGGTCTTCAAC
GCCTTCACCGTCTCCGCCGTGGACAACGGGAAGTCGGACCGGCCCGGGACGAGCAAGTCGAGCCGGACCAGTCCC
CAGTCGTCCGTCTCCCCAGCATCCACCAACTTCCCGCCCATGCCCACCACGCCGCTGTCGCGTAGCGACTCCGGC
TTCGCCCTGACGGCCACGCTGCGCGAGAAGCGCTCCGGGCACTTCGGCGAAGAGAAGTGCCGCCGCAGCTCGTCA
TTTGGCCTGGACAAGTTTCAGTCGGCGCACCGGTCGGGCGTGCCCTTCCTCAACGGTCACCAGCCCAACGCCTCC
ATCTCGGGCATCTCCGTCGACTCGCACTCCTCCTTCGGCGGAGGCTACGCGCCGTCTACGTATGCGCAGTCGACC
CTGGCCGCCTCGACCATCATGCCCAACATGCAAATCCAGCCCGTGCGGAACACGGAGACGACGGTCTGGGTGGAG
GGCCACTGCTTCGACCTCAACCCCAAGGACGCGGGCTCGCTTTGCGCCATCTGCGAGGAGCGACCGGACATTGAC
GGCATATACCAGTGCGCGGCCTGCAAGGCCTGCGCCCACAGCAGGTGCCTGGGCCAGGTGTCCCTCGTCTGCCCG
GAGGCTTTCCACGCGGACCGGGTCAGGGCCGCGTTCGTGCGCTGCATGGCCAGCCTGCTGTACACGTACAGGAAA
CACCTCGGCCGGCCCTCGAAGCAGCAGAAGAGCAACGGTCAGCTGTACGCGTTCGACATGGACGGCTTCATCAAG
AGCCTGCCGTACGACCAACAGGAGTACGCCGCGGTGCTGCGGGACACGCAGGCTTTCAACGAGTTCATACACCAA
CGCGAAACATTGGCGGCGACGGACCCGCCGGTTCGACTTTTCGACGAGATCATCATGGCGAAGAAGGCCCGCGGC
CGCCCGGGCTTGCCCTCCGGCCTGTCGCGCCTCTCCACCATCCGCGCGTCTCACGGTGCGTCGACCAACGCCTGG
AACGTGGCGCCGCCCGCACGAAGCGCCGCCAGCAAGACGCCCGGCTACCTCACGGACACGTCGGACCACATCTGG
CGAACGGCATCGGTTCCCCTGCCCAAGGGGAACTTTCCCGGCGAGTACCGCTCGGTCGTGACGCGGATACCGTCC
CGGCTCGACCGTGCGCTGATGCGCGAGCCGCGCGCCATCCAAGGGGTTCCCCGCGTGGAGCAGCGAGGCACGCGG
GGCCTCGTCCGCAAGCAGGTGCCCAGCATGCTCGGCACGACGCCGCCGGCGTGA
Gene >Hirsu2|4224
ATGCACCCGCTCAAGCGACGATTCGAGCCCGTGCTGCTCGACCGATACCCGCCCAAGACGGCCACCGACGAGATC
CCTAAGCGAGGCAAATTCCCCGACTACGTCCCCATGTTCGCCTTCCCCAACGACATCCAGATCGTCTCGTCCGAC
GACCGGCCGCGCTCGACCTGGCACGGCTTCACCATGACCTCGGAGGACAACTCCAAACTGTACGGCATCACCATC
ATCATATGGACGGCCCTTACGGCCGACGTGGCCGAGGACATCGAGACCAAGTGCGAGCTGTGGCGCCAGAACCAC
ATGTCCAACGAGGAGCGGGAGCTGGCGGCGAGCCTGGGGGTGCGCCTGGCGGGCGAACGCTCTCACCTCTCCCAC
CTGCTGTCCAAGCTCCCCACGATACCTTCGGGCTCCGCGGCCCGCGACAGACTCGAGGACGAGATCGGCACCGTC
GAGGAGAAGATCGCCCTGATGACGGACATGCTGCGGCCCCTGCGCCACGGCGCGGCCTCCAAGATCGAGGGGCTC
ACGGCCGGCGAGAGCGGGCTCTGGATACCGCGTGCGTACGGCGTCCTGGGGAGAGACCCGGCCAACATGTCCTTC
TGGAAGGAATGGCTGAGGTCCATCCTGATCCCCATGACGGACGGGAGCGTCCTGCGCGTCCCGCCCAGCTCCCCC
AAGGTCGGGCGTTGGCAGCCCCTGGAACGCTACGTCGTCAACCTGTGCACCGAGGCCTTCAGCCCCCTCGGCTCC
AAGACGCAAGTCGAGCTCGGCGTGCGGGAGCTGAGGCTTTACTCGCGCAAGGAGGGCAGCAACGAGCTGCCCGGG
TCCAGGACGGTCGACCTCTACGCTCTCTTTCGGTCTCTCTCCCTCGAGAACATCGTCGCGCTCTTCGAGTACGCC
ATGTCCGAGTCCAGGATCATCTTCCTCTCGTCCCACACCAGCATGCTGCATCTTGCCTGCCATGCGCTGGCCAGC
CTGCTCTACCCCTTCAAGTGGGCGAGCATCTTCATCCCCGTCCTGCCCGCGAGGCTGATCTCCGCCCTCGAGGCC
CCGTGCCCCTACATCGTCGGCGTCGAGCGCCGCTACGAGAGGATCGAGCTGCCCGAGGACGACTACGTCCTCGTC
GACCTGGACAAGGACACCATCGACGCCACCTCCCAGCCCCATCGGCTCCCCAGGCCACATCGGCGGAAGCTCATG
TCGCTGCTGCAAGTGGCGGCTCCCCACATGTTGCGCTACGGCGTGGCCGTCGGCCCCCCTCCATATGCGATCGAG
TCCTTTCCCTACGATTCCTTCTCGTCCGAGAACGGCTCGGTCTTGTCGCCGATCCCCCCCCCGGCCACCCTGGGC
AAATGGGTCTCCCAGAACTCGTCGAGCTTTGGCGAGCCGGACCCCCCGGATCAGGTCCACCCCCCGGTCTTCAAC
GCCTTCACCGTCTCCGCCGTGGACAACGGGAAGTCGGACCGGCCCGGGACGAGCAAGTCGAGCCGGACCAGTCCC
CAGTCGTCCGTCTCCCCAGCATCCACCAACTTCCCGCCCATGCCCACCACGCCGCTGTCGCGTAGCGACTCCGGC
TTCGCCCTGACGGCCACGCTGCGCGAGAAGCGCTCCGGGCACTTCGGCGAAGAGAAGTGCCGCCGCAGCTCGTCA
TTTGGCCTGGACAAGTTTCAGTCGGCGCACCGGTCGGGCGTGCCCTTCCTCAACGGTCACCAGCCCAACGCCTCC
ATCTCGGGCATCTCCGTCGACTCGCACTCCTCCTTCGGCGGAGGCTACGCGCCGTCTACGTATGCGCAGTCGACC
CTGGCCGCCTCGACCATCATGCCCAACATGCAAATCCAGCCCGTGCGGAACACGGAGACGACGGTCTGGGTGGAG
GGCCACTGCTTCGACCTCAACCCCAAGGACGCGGGCTCGCTTTGCGCCATCTGCGAGGAGCGACCGGACATTGAC
GGCATATACCAGTGCGCGGCCTGCAAGGCCTGCGCCCACAGCAGGTGCCTGGGCCAGGTGTCCCTCGTCTGCCCG
GAGGCTTTCCACGCGGACCGGGTCAGGGCCGCGTTCGTGCGCTGCATGGCCAGCCTGCTGTACACGTACAGGAAA
CACCTCGGCCGGCCCTCGAAGCAGCAGAAGAGCAACGGTCAGCTGTACGCGTTCGACATGGACGGCTTCATCAAG
AGCCTGCCGTACGACCAACAGGAGTACGCCGCGGTGCTGCGGGACACGCAGGGTACGTATCCGAGCGTCTCGTTT
TGTTTTGACCGTCCAGTCTCGGAGCATGTTGTGCCGCGACCTGTTCGGTACGACAAGGTTGGCACGCTAACGCCA
CGCCCTCACTAGCTTTCAACGAGTTCATACACCAACGCGAAACATTGGCGGCGACGGACCCGCCGGTTCGACTTT
TCGACGAGATCATCATGGCGAAGAAGGCCCGCGGCCGCCCGGGCTTGCCCTCCGGCCTGTCGCGCCTCTCCACCA
TCCGCGCGTCTCACGGTGCGTCGACCAACGCCTGGAACGTGGCGCCGCCCGCACGAAGCGCCGCCAGCAAGACGC
CCGGCTACCTCACGGACACGTCGGACCACATCTGGCGAACGGCATCGGTTCCCCTGCCCAAGGGGAACTTTCCCG
GCGAGTACCGCTCGGTCGTGACGCGGATACCGTCCCGGCTCGACCGTGCGCTGATGCGCGAGCCGCGCGCCATCC
AAGGGGTTCCCCGCGTGGAGCAGCGAGGCACGCGGGGCCTCGTCCGCAAGCAGGTGCCCAGCATGCTCGGCACGA
CGCCGCCGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail