Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4216
Gene name
LocationContig_217:18198..20162
Strand-
Gene length (bp)1964
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 6.8E-25 328 520

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46634|CP7A1_CRIGR Cholesterol 7-alpha-monooxygenase OS=Cricetulus griseus GN=CYP7A1 PE=3 SV=1 201 556 6.0E-21
sp|Q64505|CP7A1_MOUSE Cholesterol 7-alpha-monooxygenase OS=Mus musculus GN=Cyp7a1 PE=2 SV=2 201 556 2.0E-20
sp|P18125|CP7A1_RAT Cholesterol 7-alpha-monooxygenase OS=Rattus norvegicus GN=Cyp7a1 PE=1 SV=1 201 556 2.0E-19
sp|P51542|CP7A1_RABIT Cholesterol 7-alpha-monooxygenase OS=Oryctolagus cuniculus GN=CYP7A1 PE=1 SV=1 196 554 3.0E-18
sp|P22680|CP7A1_HUMAN Cholesterol 7-alpha-monooxygenase OS=Homo sapiens GN=CYP7A1 PE=1 SV=2 201 554 8.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46634|CP7A1_CRIGR Cholesterol 7-alpha-monooxygenase OS=Cricetulus griseus GN=CYP7A1 PE=3 SV=1 201 556 6.0E-21
sp|Q64505|CP7A1_MOUSE Cholesterol 7-alpha-monooxygenase OS=Mus musculus GN=Cyp7a1 PE=2 SV=2 201 556 2.0E-20
sp|P18125|CP7A1_RAT Cholesterol 7-alpha-monooxygenase OS=Rattus norvegicus GN=Cyp7a1 PE=1 SV=1 201 556 2.0E-19
sp|P51542|CP7A1_RABIT Cholesterol 7-alpha-monooxygenase OS=Oryctolagus cuniculus GN=CYP7A1 PE=1 SV=1 196 554 3.0E-18
sp|P22680|CP7A1_HUMAN Cholesterol 7-alpha-monooxygenase OS=Homo sapiens GN=CYP7A1 PE=1 SV=2 201 554 8.0E-17
sp|O46491|CP7A1_PIG Cholesterol 7-alpha-monooxygenase OS=Sus scrofa GN=CYP7A1 PE=3 SV=1 277 556 4.0E-16
sp|Q9UNU6|CP8B1_HUMAN 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Homo sapiens GN=CYP8B1 PE=1 SV=2 310 554 1.0E-15
sp|O35074|PTGIS_MOUSE Prostacyclin synthase OS=Mus musculus GN=Ptgis PE=1 SV=1 324 556 3.0E-15
sp|O02766|CP8B1_RABIT 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Oryctolagus cuniculus GN=CYP8B1 PE=1 SV=3 321 556 9.0E-15
sp|O75881|CP7B1_HUMAN 25-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP7B1 PE=1 SV=2 39 556 3.0E-14
sp|Q62969|PTGIS_RAT Prostacyclin synthase OS=Rattus norvegicus GN=Ptgis PE=2 SV=1 324 556 8.0E-14
sp|Q29626|PTGIS_BOVIN Prostacyclin synthase OS=Bos taurus GN=PTGIS PE=1 SV=1 299 556 8.0E-14
sp|Q60991|CP7B1_MOUSE 25-hydroxycholesterol 7-alpha-hydroxylase OS=Mus musculus GN=Cyp7b1 PE=2 SV=2 332 517 4.0E-13
sp|Q7YRB2|CP8B1_PIG 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase OS=Sus scrofa GN=CYP8B1 PE=2 SV=1 299 556 7.0E-13
sp|Q63688|CP7B1_RAT 25-hydroxycholesterol 7-alpha-hydroxylase (Fragment) OS=Rattus norvegicus GN=Cyp7b1 PE=1 SV=1 332 556 2.0E-12
sp|Q16647|PTGIS_HUMAN Prostacyclin synthase OS=Homo sapiens GN=PTGIS PE=1 SV=1 324 556 3.0E-12
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 321 514 6.0E-12
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 317 529 2.0E-11
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 310 513 5.0E-11
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 309 522 2.0E-10
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 317 517 3.0E-10
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 317 532 6.0E-10
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 308 513 7.0E-10
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 317 517 9.0E-10
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 324 513 1.0E-09
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 327 518 1.0E-09
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 310 513 2.0E-09
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 327 556 2.0E-09
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 311 524 2.0E-09
sp|P49602|CP51_USTMA Lanosterol 14-alpha demethylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG11 PE=3 SV=1 200 512 3.0E-09
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 326 507 3.0E-09
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 328 513 3.0E-09
sp|Q7XHW5|C14B1_ORYSJ Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica GN=CYP714B1 PE=1 SV=2 333 518 3.0E-09
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 307 513 5.0E-09
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 234 522 5.0E-09
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 329 517 1.0E-08
sp|Q0DS59|C14B2_ORYSJ Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 326 516 1.0E-08
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 325 517 1.0E-08
sp|B6SSW8|C14B3_MAIZE Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 326 516 2.0E-08
sp|H1A988|C7254_GLYUR 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 307 516 2.0E-08
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 317 512 2.0E-08
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 337 513 2.0E-08
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 324 530 2.0E-08
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 315 513 3.0E-08
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 328 541 3.0E-08
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 314 532 3.0E-08
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 324 513 4.0E-08
sp|Q07973|CP24A_HUMAN 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 288 515 4.0E-08
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 324 539 6.0E-08
sp|P29980|CPXN_NOSS1 Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 323 514 6.0E-08
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 329 513 7.0E-08
sp|Q12664|CP51_PENIT Eburicol 14-alpha-demethylase OS=Penicillium italicum GN=CYP51 PE=3 SV=1 47 556 7.0E-08
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 313 513 8.0E-08
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 331 513 8.0E-08
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 319 514 9.0E-08
sp|O48921|C97B2_SOYBN Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 324 516 1.0E-07
sp|Q9NYL5|CP39A_HUMAN 24-hydroxycholesterol 7-alpha-hydroxylase OS=Homo sapiens GN=CYP39A1 PE=2 SV=2 332 556 1.0E-07
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 320 535 2.0E-07
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 275 513 2.0E-07
sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 333 507 2.0E-07
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 340 527 2.0E-07
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 307 513 3.0E-07
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 329 513 3.0E-07
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 324 532 3.0E-07
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 324 539 3.0E-07
sp|Q93Z79|C14A1_ARATH Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 304 513 3.0E-07
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 329 513 4.0E-07
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 319 497 5.0E-07
sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 213 513 5.0E-07
sp|Q09J78|ABAH2_ORYSI Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. indica GN=CYP707A6 PE=2 SV=1 327 522 6.0E-07
sp|Q6ZDE3|ABAH2_ORYSJ Abscisic acid 8'-hydroxylase 2 OS=Oryza sativa subsp. japonica GN=CYP707A6 PE=2 SV=1 327 522 6.0E-07
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 322 513 6.0E-07
sp|H1A981|C7263_MEDTR 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 296 516 7.0E-07
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 322 513 7.0E-07
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 322 513 7.0E-07
sp|B9G934|C14C3_ORYSJ Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 333 512 8.0E-07
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 266 552 8.0E-07
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 340 539 9.0E-07
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 331 512 1.0E-06
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 340 516 1.0E-06
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 324 539 1.0E-06
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 328 513 1.0E-06
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 300 518 1.0E-06
sp|Q759W0|CP51_ASHGO Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 319 556 1.0E-06
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 320 513 1.0E-06
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 314 513 1.0E-06
sp|Q9UVC3|CP51_CUNEL Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 310 553 2.0E-06
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 328 513 2.0E-06
sp|Q9LUC6|C7A14_ARATH Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 328 516 2.0E-06
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 324 539 2.0E-06
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 340 513 2.0E-06
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 325 517 2.0E-06
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 330 513 2.0E-06
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 272 513 3.0E-06
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 304 513 3.0E-06
sp|A2Z212|ABAH3_ORYSI Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 305 535 3.0E-06
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 328 514 3.0E-06
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 265 516 3.0E-06
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 265 513 3.0E-06
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 332 535 4.0E-06
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 317 517 4.0E-06
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 327 530 4.0E-06
sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 337 513 4.0E-06
sp|Q0J185|ABAH3_ORYSJ Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 305 522 5.0E-06
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 328 514 5.0E-06
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 325 540 5.0E-06
sp|Q9XHE6|C71DF_MENPI Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 314 513 5.0E-06
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 330 520 6.0E-06
sp|O88962|CP8B1_MOUSE 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase OS=Mus musculus GN=Cyp8b1 PE=1 SV=1 310 556 7.0E-06
sp|Q9V676|CP6T3_DROME Probable cytochrome P450 6t3 OS=Drosophila melanogaster GN=Cyp6t3 PE=3 SV=1 325 515 7.0E-06
sp|P48522|TCMO_CATRO Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 340 514 7.0E-06
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 337 513 8.0E-06
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 305 513 8.0E-06
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 339 513 8.0E-06
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 325 513 8.0E-06
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 324 518 9.0E-06
sp|Q949P1|ABAH1_ARATH Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 233 533 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4216
MAQFIDWRPAAGRMVDLAKGHWLVTAACLGLAVAFACAARLGRRADEPPSLPEWLPFVVNTYRYMSDRKKLMDRI
RPLVSRHKVAMLWIIGKPVYVVSGDIVRMMFRSSESMNADNLSLLILKNLQGLSAEDVAKFANDKSGRLKTPGRG
HEHVPADQRYWAANHDLHHDHLLPAEATAQLARSYETFFTQRLEMQPLGRWVTLGIHDVLKRDMVWAATSSLCGT
LLLDMYPDFIAAFWDLDSVIDKLLWGLPRWLYPGPLRVREKVFGMCGRYLEEAFKRFDWDGPDATAGWEPIFGSR
YARERAKSTRDAGFTWQSRISFHMISIIALNSNTTPVTAWAMFELIKDPSLFEALRAEVETSLVSDPETGCRRFD
TSRLLTLPLLQSVYVETLRLHVAVLITRQLIEPIHVGPYQLRKGAWLQAPPNFSHLDDALWGADSSHPASEFWAK
RHVVEEETEEAVTGQRIQKQKFVMEARPSEFFPFGGGHTMCPGRNLARQEIMMTIAMIVSRFDIEFVHWVDKNGG
ISTGLPRDDTKYYGFGAMPPDRDARIRWRRRW*
Coding >Hirsu2|4216
ATGGCGCAGTTCATCGACTGGAGGCCGGCGGCCGGCCGAATGGTCGACTTGGCCAAGGGTCACTGGCTGGTGACG
GCGGCGTGCCTCGGCTTGGCCGTCGCCTTCGCGTGCGCTGCTCGGCTCGGTCGCCGGGCGGACGAGCCGCCCTCG
CTTCCCGAGTGGCTTCCCTTTGTCGTCAACACGTATCGGTACATGAGCGACCGGAAGAAACTCATGGACCGAATC
AGGCCTCTCGTCAGTCGGCACAAAGTGGCCATGCTCTGGATCATTGGGAAGCCCGTGTACGTCGTTTCCGGCGAC
ATTGTCCGAATGATGTTTCGTTCGTCCGAAAGCATGAACGCCGACAACTTGAGCTTGCTCATCCTCAAAAATCTC
CAAGGCCTCAGCGCCGAGGACGTGGCCAAGTTCGCCAACGACAAATCCGGCCGGCTCAAGACGCCCGGACGAGGT
CATGAGCACGTCCCCGCCGACCAGCGTTACTGGGCCGCAAACCACGACCTGCACCACGACCACCTGCTCCCGGCC
GAGGCGACGGCCCAGCTGGCCCGCTCGTACGAAACCTTCTTCACCCAGAGGTTGGAGATGCAGCCGCTTGGGCGG
TGGGTGACTCTGGGCATCCACGATGTCCTCAAGCGCGACATGGTATGGGCCGCCACCTCGTCGCTCTGCGGTACC
CTTCTGCTGGACATGTACCCGGACTTCATCGCCGCTTTCTGGGACCTTGACAGCGTCATAGACAAGCTTCTGTGG
GGCCTGCCGAGGTGGCTGTACCCCGGCCCGCTCAGGGTTAGAGAAAAGGTGTTTGGAATGTGTGGTAGGTATCTG
GAAGAGGCCTTCAAGAGGTTCGACTGGGACGGACCTGATGCCACTGCCGGCTGGGAGCCCATCTTTGGGTCGAGG
TATGCGCGCGAGCGGGCAAAGTCGACTCGTGATGCTGGATTCACCTGGCAGAGTCGCATTAGCTTCCACATGATC
TCCATCATCGCACTCAACTCCAACACGACGCCCGTCACGGCGTGGGCCATGTTTGAATTAATCAAGGACCCTTCG
CTCTTTGAGGCCCTACGGGCCGAGGTCGAGACGTCGCTCGTCTCCGATCCGGAGACTGGATGCCGTCGATTCGAT
ACAAGTAGGCTTCTGACACTGCCACTGCTCCAGTCTGTCTACGTGGAGACCCTGAGACTGCACGTGGCCGTCCTC
ATCACGCGGCAGCTCATCGAGCCCATCCATGTCGGGCCGTATCAGCTGCGCAAGGGCGCCTGGCTTCAGGCACCG
CCCAACTTCAGCCATCTCGACGACGCGCTATGGGGAGCCGACTCAAGTCATCCTGCCTCAGAGTTTTGGGCCAAG
CGTCATGTCGTCGAAGAGGAAACAGAAGAAGCCGTAACCGGGCAGAGGATCCAGAAACAGAAATTCGTCATGGAA
GCGCGGCCCAGCGAATTCTTCCCGTTCGGCGGTGGACACACTATGTGTCCGGGTCGAAACCTCGCCAGGCAGGAG
ATCATGATGACGATAGCCATGATCGTGTCGCGCTTCGACATCGAATTCGTTCACTGGGTCGACAAGAATGGCGGA
ATATCGACCGGCCTACCGAGAGACGATACGAAGTATTACGGATTTGGCGCCATGCCTCCCGACCGAGATGCAAGA
ATTCGTTGGAGACGTCGGTGGTGA
Transcript >Hirsu2|4216
ATGGCGCAGTTCATCGACTGGAGGCCGGCGGCCGGCCGAATGGTCGACTTGGCCAAGGGTCACTGGCTGGTGACG
GCGGCGTGCCTCGGCTTGGCCGTCGCCTTCGCGTGCGCTGCTCGGCTCGGTCGCCGGGCGGACGAGCCGCCCTCG
CTTCCCGAGTGGCTTCCCTTTGTCGTCAACACGTATCGGTACATGAGCGACCGGAAGAAACTCATGGACCGAATC
AGGCCTCTCGTCAGTCGGCACAAAGTGGCCATGCTCTGGATCATTGGGAAGCCCGTGTACGTCGTTTCCGGCGAC
ATTGTCCGAATGATGTTTCGTTCGTCCGAAAGCATGAACGCCGACAACTTGAGCTTGCTCATCCTCAAAAATCTC
CAAGGCCTCAGCGCCGAGGACGTGGCCAAGTTCGCCAACGACAAATCCGGCCGGCTCAAGACGCCCGGACGAGGT
CATGAGCACGTCCCCGCCGACCAGCGTTACTGGGCCGCAAACCACGACCTGCACCACGACCACCTGCTCCCGGCC
GAGGCGACGGCCCAGCTGGCCCGCTCGTACGAAACCTTCTTCACCCAGAGGTTGGAGATGCAGCCGCTTGGGCGG
TGGGTGACTCTGGGCATCCACGATGTCCTCAAGCGCGACATGGTATGGGCCGCCACCTCGTCGCTCTGCGGTACC
CTTCTGCTGGACATGTACCCGGACTTCATCGCCGCTTTCTGGGACCTTGACAGCGTCATAGACAAGCTTCTGTGG
GGCCTGCCGAGGTGGCTGTACCCCGGCCCGCTCAGGGTTAGAGAAAAGGTGTTTGGAATGTGTGGTAGGTATCTG
GAAGAGGCCTTCAAGAGGTTCGACTGGGACGGACCTGATGCCACTGCCGGCTGGGAGCCCATCTTTGGGTCGAGG
TATGCGCGCGAGCGGGCAAAGTCGACTCGTGATGCTGGATTCACCTGGCAGAGTCGCATTAGCTTCCACATGATC
TCCATCATCGCACTCAACTCCAACACGACGCCCGTCACGGCGTGGGCCATGTTTGAATTAATCAAGGACCCTTCG
CTCTTTGAGGCCCTACGGGCCGAGGTCGAGACGTCGCTCGTCTCCGATCCGGAGACTGGATGCCGTCGATTCGAT
ACAAGTAGGCTTCTGACACTGCCACTGCTCCAGTCTGTCTACGTGGAGACCCTGAGACTGCACGTGGCCGTCCTC
ATCACGCGGCAGCTCATCGAGCCCATCCATGTCGGGCCGTATCAGCTGCGCAAGGGCGCCTGGCTTCAGGCACCG
CCCAACTTCAGCCATCTCGACGACGCGCTATGGGGAGCCGACTCAAGTCATCCTGCCTCAGAGTTTTGGGCCAAG
CGTCATGTCGTCGAAGAGGAAACAGAAGAAGCCGTAACCGGGCAGAGGATCCAGAAACAGAAATTCGTCATGGAA
GCGCGGCCCAGCGAATTCTTCCCGTTCGGCGGTGGACACACTATGTGTCCGGGTCGAAACCTCGCCAGGCAGGAG
ATCATGATGACGATAGCCATGATCGTGTCGCGCTTCGACATCGAATTCGTTCACTGGGTCGACAAGAATGGCGGA
ATATCGACCGGCCTACCGAGAGACGATACGAAGTATTACGGATTTGGCGCCATGCCTCCCGACCGAGATGCAAGA
ATTCGTTGGAGACGTCGGTGGTGA
Gene >Hirsu2|4216
ATGGCGCAGTTCATCGACTGGAGGCCGGCGGCCGGCCGAATGGTCGACTTGGCCAAGGGTCACTGGCTGGTGACG
GCGGCGTGCCTCGGCTTGGCCGTCGCCTTCGCGTGCGCTGCTCGGCTCGGTCGCCGGGCGGACGAGCCGCCCTCG
CTTCCCGAGTGGCTTCCCTTTGTCGTCAACACGTATCGGTACATGAGCGACCGGAAGAAACTCATGGACCGAATC
AGGTGGGCACTGCCTCTCCCGCTCTGTATGACGAGCAAAGCCGTGCCTGAGCACAGAGGAGGAGGAGGAAGAAAG
GCGGCGAGAGGGTTGGAGAAGCGCGCTCACATCTGCTCGCCAGGCCTCTCGTCAGTCGGCACAAAGTGGCCATGC
TCTGGATCATTGGGAAGCCCGTGTACGTCGTTTCCGGCGACATTGTCCGAATGATGTTTCGTTCGTCCGAAAGCA
TGAACGCCGACAACTTGAGCTTGCTCATCCTCAAAAATCTCCAAGGCCTCAGCGCCGAGGACGTGGCCAAGTTCG
CCAACGACAAATCCGGCCGGCTCAAGACGCCCGGACGAGGTCATGAGCACGTCCCCGCCGACCAGCGTTACTGGG
CCGCAAACCACGACCTGCACCACGACCACCTGCTCCCGGCCGAGGCGACGGCCCAGCTGGCCCGCTCGTACGAAA
CCTTCTTCACCCAGAGGTTGGAGATGCAGCCGCTTGGGCGGTGGGTGACTCTGGGCATCCACGATGTCCTCAAGC
GCGACATGGTATGGGCCGCCACCTCGTCGCTCTGCGGTACCCTTCTGCTGGACATGTACCCGGACTTCATCGCCG
CTTTCTGGGACCTTGACAGCGTCATAGACAAGCTTCTGTGGGGCCTGCCGAGGTGGCTGTACCCCGGCCCGCTCA
GGGTTAGAGAAAAGGTGTTTGGAATGTGTGGTAGGTATCTGGAAGAGGCCTTCAAGAGGTTCGACTGGGACGGAC
CTGATGCCACTGCCGGCTGGGAGCCCATCTTTGGGTCGAGGTATGCGCGCGAGCGGGCAAAGTCGACTCGTGATG
CTGGATTCACCTGGCAGAGTCGCATTAGCTTCCACATGATCTCCATCATCGCGTACGTTCCAAGCCCGTGTCGCT
GCGTCGCCGGCGCGAACAGGCGGTCCGTCTTGAGCACGCAACTCACAGGCCTGGCCGCAGACTCAACTCCAACAC
GACGCCCGTCACGGCGTGGGCCATGTTTGAATTAATCAAGGACCCTTCGCTCTTTGAGGCCCTACGGGCCGAGGT
CGAGACGTCGCTCGTCTCCGATCCGGAGACTGGATGCCGTCGATTCGATACAAGTAGGCTTCTGACACTGCCACT
GCTCCAGTCTGTCTACGTGGAGACCCTGAGACTGCACGTGGCCGTCCTCATCACGCGGCAGCTCATCGAGCCCAT
CCATGTCGGGCCGTATCAGCTGCGCAAGGGCGCCTGGCTTCAGGCACCGCCCAACTTCAGCCATCTCGACGACGC
GCTATGGGGAGCCGACTCAAGTCATCCTGCCTCAGAGTTTTGGGCCAAGCGTCATGTCGTCGAAGAGGAAACAGA
AGAAGCCGTAACCGGGCAGAGGATCCAGAAACAGAAATTCGTCATGGAAGCGCGGCCCAGCGAATTCTTCCCGTT
CGGTACGTACGCCCGCGGTGCTATGCCGAGCAACCACCGTTTTGCAAGCCAATGCGTCCAGAGAGTTTACGAAAC
TGACGGTTCTGGAAAAAGGCGGTGGACACACTATGTGTCCGGGTCGAAACCTCGCCAGGCAGGAGATCATGATGA
CGATAGCCATGATCGTGTCGCGCTTCGACATCGAATTCGTTCACTGGGTCGACAAGAATGGCGGAATATCGACCG
GCCTACCGAGAGACGATACGAAGTATTACGGATTTGGCGCCATGCCTCCCGACCGAGATGCAAGAATTCGTTGGA
GACGTCGGTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail