Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4210
Gene name
LocationContig_217:5061..5964
Strand-
Gene length (bp)903
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00240 ubiquitin Ubiquitin family 1.3E-33 40 111
PF01599 Ribosomal_S27 Ribosomal protein S27a 7.0E-26 139 184
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 8.0E-16 38 108
PF14560 Ubiquitin_2 Ubiquitin-like domain 1.6E-04 48 106

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14799|RS27A_NEUCR Ubiquitin-40S ribosomal protein S27a OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi::crp-6 PE=1 SV=4 38 189 8.0E-82
sp|P62979|RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P62978|RS27A_CAVPO Ubiquitin-40S ribosomal protein S27a OS=Cavia porcellus GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P62992|RS27A_BOVIN Ubiquitin-40S ribosomal protein S27a OS=Bos taurus GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P68200|RS27A_ICTPU Ubiquitin-40S ribosomal protein S27a OS=Ictalurus punctatus GN=rps27a PE=2 SV=2 38 189 2.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14799|RS27A_NEUCR Ubiquitin-40S ribosomal protein S27a OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi::crp-6 PE=1 SV=4 38 189 8.0E-82
sp|P62979|RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P62978|RS27A_CAVPO Ubiquitin-40S ribosomal protein S27a OS=Cavia porcellus GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P62992|RS27A_BOVIN Ubiquitin-40S ribosomal protein S27a OS=Bos taurus GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P68200|RS27A_ICTPU Ubiquitin-40S ribosomal protein S27a OS=Ictalurus punctatus GN=rps27a PE=2 SV=2 38 189 2.0E-79
sp|P79781|RS27A_CHICK Ubiquitin-40S ribosomal protein S27a OS=Gallus gallus GN=RPS27A PE=2 SV=3 38 189 3.0E-79
sp|P15357|RS27A_DROME Ubiquitin-40S ribosomal protein S27a OS=Drosophila melanogaster GN=RpS27A PE=1 SV=2 38 189 5.0E-79
sp|P62982|RS27A_RAT Ubiquitin-40S ribosomal protein S27a OS=Rattus norvegicus GN=Rps27a PE=1 SV=2 38 189 5.0E-79
sp|P62983|RS27A_MOUSE Ubiquitin-40S ribosomal protein S27a OS=Mus musculus GN=Rps27a PE=1 SV=2 38 189 5.0E-79
sp|P68202|RS27A_PLUXY Ubiquitin-40S ribosomal protein S27a OS=Plutella xylostella PE=2 SV=2 38 187 6.0E-77
sp|P29504|RS27A_MANSE Ubiquitin-40S ribosomal protein S27a OS=Manduca sexta PE=2 SV=2 38 187 2.0E-76
sp|P68203|RS27A_SPOFR Ubiquitin-40S ribosomal protein S27a OS=Spodoptera frugiperda PE=2 SV=2 38 187 4.0E-76
sp|P59271|R27AA_ARATH Ubiquitin-40S ribosomal protein S27a-1 OS=Arabidopsis thaliana GN=RPS27AA PE=1 SV=2 38 189 1.0E-75
sp|P14797|RS27A_DICDI Ubiquitin-40S ribosomal protein S27a OS=Dictyostelium discoideum GN=ubqC PE=1 SV=2 38 186 9.0E-75
sp|P59232|R27AB_ARATH Ubiquitin-40S ribosomal protein S27a-2 OS=Arabidopsis thaliana GN=RPS27AB PE=1 SV=2 38 190 1.0E-74
sp|P59233|R27AC_ARATH Ubiquitin-40S ribosomal protein S27a-3 OS=Arabidopsis thaliana GN=RPS27AC PE=1 SV=2 38 190 2.0E-74
sp|P69061|RS27A_KLULA Ubiquitin-40S ribosomal protein S27a OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi3 PE=1 SV=2 38 189 4.0E-74
sp|P62981|RS27A_SOLTU Ubiquitin-40S ribosomal protein S27a OS=Solanum tuberosum GN=UBI3 PE=2 SV=2 38 189 4.0E-73
sp|P62980|RS27A_SOLLC Ubiquitin-40S ribosomal protein S27a OS=Solanum lycopersicum GN=UBI3 PE=3 SV=2 38 189 4.0E-73
sp|P47905|RS27A_LUPAL Ubiquitin-40S ribosomal protein S27a OS=Lupinus albus PE=3 SV=2 38 189 7.0E-72
sp|Q9ARZ9|R27AA_ORYSJ Ubiquitin-40S ribosomal protein S27a-1 OS=Oryza sativa subsp. japonica GN=RPS27AA PE=2 SV=1 38 190 2.0E-71
sp|P27923|RS27A_MAIZE Ubiquitin-40S ribosomal protein S27a OS=Zea mays GN=UBF9 PE=2 SV=2 38 190 2.0E-71
sp|P51431|R27AB_ORYSJ Ubiquitin-40S ribosomal protein S27a-2 OS=Oryza sativa subsp. japonica GN=RPS27AB PE=2 SV=3 38 190 4.0E-71
sp|P0CG87|RS272_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB2 PE=3 SV=1 38 190 1.0E-70
sp|P0CG86|RS271_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB1 PE=3 SV=1 38 190 1.0E-70
sp|P05759|RS27A_YEAST Ubiquitin-40S ribosomal protein S31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS31 PE=1 SV=3 38 185 4.0E-70
sp|P0C8R3|RS27B_SCHPO Ubiquitin-40S ribosomal protein S27b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi5 PE=1 SV=2 38 184 5.0E-67
sp|P0C016|RS27A_SCHPO Ubiquitin-40S ribosomal protein S27a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi3 PE=1 SV=2 38 184 7.0E-67
sp|P59272|RS27A_DAUCA Ubiquitin-40S ribosomal protein S27a (Fragment) OS=Daucus carota PE=2 SV=2 38 180 3.0E-64
sp|P37164|RS27A_CAEBR Ubiquitin-like protein 1-40S ribosomal protein S27a OS=Caenorhabditis briggsae GN=ubl-1 PE=1 SV=2 40 188 2.0E-48
sp|P37165|RS27A_CAEEL Ubiquitin-like protein 1-40S ribosomal protein S27a OS=Caenorhabditis elegans GN=ubl-1 PE=1 SV=2 40 188 2.0E-47
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 22 115 3.0E-47
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 22 113 3.0E-47
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 22 115 3.0E-47
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 22 113 4.0E-47
sp|P19848|UBIQ_COPCO Ubiquitin OS=Coprinellus congregatus PE=1 SV=1 38 113 8.0E-47
sp|P0CG74|UBI4P_CANAX Polyubiquitin OS=Candida albicans GN=UBI4 PE=1 SV=1 22 115 2.0E-46
sp|P0CG74|UBI4P_CANAX Polyubiquitin OS=Candida albicans GN=UBI4 PE=1 SV=1 22 115 2.0E-46
sp|P0CG74|UBI4P_CANAX Polyubiquitin OS=Candida albicans GN=UBI4 PE=1 SV=1 22 113 2.0E-46
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 22 115 2.0E-46
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 22 113 2.0E-46
sp|P69310|UBIQ_AVESA Ubiquitin OS=Avena sativa PE=1 SV=1 38 113 2.0E-46
sp|P69326|UBIQ_WHEAT Ubiquitin OS=Triticum aestivum PE=3 SV=2 38 113 2.0E-46
sp|Q3E7K8|UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana GN=UBQ12 PE=3 SV=1 26 115 2.0E-46
sp|P69317|UBIQ_LUPPO Ubiquitin OS=Lupinus polyphyllus PE=3 SV=2 38 113 2.0E-46
sp|P69313|UBIQ_HELAN Ubiquitin OS=Helianthus annuus PE=3 SV=2 38 113 2.0E-46
sp|P40909|RL40_CRYNJ Ubiquitin-60S ribosomal protein L40 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBI1 PE=1 SV=2 38 113 3.0E-46
sp|P0CH07|RL402_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uep1 PE=1 SV=1 38 113 4.0E-46
sp|P0CH06|RL401_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi1 PE=1 SV=1 38 113 4.0E-46
sp|P0CH09|RL402_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40B PE=1 SV=1 38 113 4.0E-46
sp|P0CH08|RL401_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40A PE=1 SV=1 38 113 4.0E-46
sp|P0CG72|UBI4P_SCHPO Polyubiquitin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG72|UBI4P_SCHPO Polyubiquitin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG72|UBI4P_SCHPO Polyubiquitin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG63|UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBI4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG63|UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBI4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG63|UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBI4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG75|UBI4P_KLULA Polyubiquitin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG75|UBI4P_KLULA Polyubiquitin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG75|UBI4P_KLULA Polyubiquitin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 22 114 8.0E-46
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 22 115 9.0E-46
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 22 115 9.0E-46
sp|P0CG72|UBI4P_SCHPO Polyubiquitin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi4 PE=1 SV=1 22 113 1.0E-45
sp|P0CG63|UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBI4 PE=1 SV=1 22 113 1.0E-45
sp|P0CG75|UBI4P_KLULA Polyubiquitin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi4 PE=1 SV=1 22 113 1.0E-45
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 22 115 1.0E-45
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 22 115 1.0E-45
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 22 113 1.0E-45
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 22 115 1.0E-45
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 22 115 1.0E-45
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 22 113 1.0E-45
sp|P62972|UBIQP_XENLA Polyubiquitin (Fragment) OS=Xenopus laevis PE=1 SV=2 31 115 1.0E-45
sp|P62972|UBIQP_XENLA Polyubiquitin (Fragment) OS=Xenopus laevis PE=1 SV=2 31 113 1.0E-45
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 22 115 1.0E-45
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 22 115 1.0E-45
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 22 113 1.0E-45
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 22 115 1.0E-45
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 22 115 1.0E-45
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 22 113 1.0E-45
sp|P31753|RS27A_ASPOF Ubiquitin-40S ribosomal protein S27a (Fragment) OS=Asparagus officinalis PE=2 SV=2 74 189 1.0E-45
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 22 115 1.0E-45
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 22 115 1.0E-45
sp|P51423|RL40_BRARP Ubiquitin-60S ribosomal protein L40 OS=Brassica rapa subsp. pekinensis PE=2 SV=2 38 113 1.0E-45
sp|P0CH35|RL40B_ORYSJ Ubiquitin-60S ribosomal protein L40-2 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-2 PE=3 SV=1 38 113 2.0E-45
sp|P0CH34|RL40A_ORYSJ Ubiquitin-60S ribosomal protein L40-1 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-1 PE=2 SV=1 38 113 2.0E-45
sp|Q8RUC6|RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana GN=RUB2 PE=1 SV=3 38 113 2.0E-45
sp|P23398|UBIQP_STRPU Polyubiquitin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=2 31 113 2.0E-45
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 38 113 2.0E-45
sp|P0C073|RUB1_DESAN Ubiquitin-NEDD8-like protein RUB1 OS=Deschampsia antarctica GN=RUB1 PE=2 SV=2 38 113 2.0E-45
sp|P49636|RL40_NICSY Ubiquitin-60S ribosomal protein L40 OS=Nicotiana sylvestris GN=UBICEP52-7 PE=2 SV=2 38 113 2.0E-45
sp|P0C030|RUB1_ORYSJ Ubiquitin-NEDD8-like protein RUB1 OS=Oryza sativa subsp. japonica GN=RUB1 PE=2 SV=2 38 113 2.0E-45
sp|Q42202|RL40B_ARATH Ubiquitin-60S ribosomal protein L40-2 OS=Arabidopsis thaliana GN=RPL40B PE=1 SV=2 38 113 2.0E-45
sp|B9DHA6|RL40A_ARATH Ubiquitin-60S ribosomal protein L40-1 OS=Arabidopsis thaliana GN=RPL40A PE=1 SV=1 38 113 2.0E-45
sp|P0C224|RL40_NEUCR Ubiquitin-60S ribosomal protein L40 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-79 PE=1 SV=2 38 113 2.0E-45
sp|Q9SHE7|RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana GN=RUB1 PE=1 SV=3 38 113 2.0E-45
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 22 115 3.0E-45
sp|P0CH32|UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana GN=UBQ4 PE=1 SV=1 22 114 4.0E-45
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 22 115 4.0E-45
sp|P0CH32|UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana GN=UBQ4 PE=1 SV=1 22 115 5.0E-45
sp|P0CH32|UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana GN=UBQ4 PE=1 SV=1 22 115 5.0E-45
sp|P0CH32|UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana GN=UBQ4 PE=1 SV=1 22 115 5.0E-45
sp|P0CG84|UBI4P_NICSY Polyubiquitin (Fragment) OS=Nicotiana sylvestris GN=UBI4 PE=2 SV=1 22 115 5.0E-45
sp|P0CG84|UBI4P_NICSY Polyubiquitin (Fragment) OS=Nicotiana sylvestris GN=UBI4 PE=2 SV=1 22 115 5.0E-45
sp|P0CG84|UBI4P_NICSY Polyubiquitin (Fragment) OS=Nicotiana sylvestris GN=UBI4 PE=2 SV=1 22 115 5.0E-45
sp|P69322|UBIQP_PEA Polyubiquitin OS=Pisum sativum GN=PU1 PE=2 SV=2 22 115 5.0E-45
sp|P69322|UBIQP_PEA Polyubiquitin OS=Pisum sativum GN=PU1 PE=2 SV=2 22 115 5.0E-45
sp|P69322|UBIQP_PEA Polyubiquitin OS=Pisum sativum GN=PU1 PE=2 SV=2 22 115 5.0E-45
sp|Q58G87|UBQ3_ORYSJ Polyubiquitin 3 OS=Oryza sativa subsp. japonica GN=UBQ3 PE=2 SV=2 22 115 5.0E-45
sp|Q58G87|UBQ3_ORYSJ Polyubiquitin 3 OS=Oryza sativa subsp. japonica GN=UBQ3 PE=2 SV=2 22 115 5.0E-45
sp|Q58G87|UBQ3_ORYSJ Polyubiquitin 3 OS=Oryza sativa subsp. japonica GN=UBQ3 PE=2 SV=2 22 115 5.0E-45
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 22 113 6.0E-45
sp|P0CG84|UBI4P_NICSY Polyubiquitin (Fragment) OS=Nicotiana sylvestris GN=UBI4 PE=2 SV=1 22 113 6.0E-45
sp|P69322|UBIQP_PEA Polyubiquitin OS=Pisum sativum GN=PU1 PE=2 SV=2 22 113 6.0E-45
sp|Q58G87|UBQ3_ORYSJ Polyubiquitin 3 OS=Oryza sativa subsp. japonica GN=UBQ3 PE=2 SV=2 22 113 6.0E-45
sp|P0CH10|RL403_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI3 PE=1 SV=1 38 113 6.0E-45
sp|P0CH11|RL401_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI1 PE=1 SV=1 38 113 6.0E-45
sp|P62975|UBIQ_RABIT Ubiquitin OS=Oryctolagus cuniculus PE=1 SV=1 38 113 7.0E-45
sp|P68197|UBIQ_CERCA Ubiquitin OS=Ceratitis capitata PE=1 SV=1 38 113 7.0E-45
sp|Q865C5|UBIQ_CAMDR Ubiquitin OS=Camelus dromedarius PE=3 SV=2 38 113 7.0E-45
sp|P0CG77|UBIQD_DICDI Polyubiquitin-D OS=Dictyostelium discoideum GN=ubqD PE=1 SV=1 22 115 8.0E-45
sp|P0CG74|UBI4P_CANAX Polyubiquitin OS=Candida albicans GN=UBI4 PE=1 SV=1 38 115 9.0E-45
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 38 115 9.0E-45
sp|P0CG77|UBIQD_DICDI Polyubiquitin-D OS=Dictyostelium discoideum GN=ubqD PE=1 SV=1 22 113 9.0E-45
sp|P49632|RL40_CAEEL Ubiquitin-60S ribosomal protein L40 OS=Caenorhabditis elegans GN=ubq-2 PE=3 SV=2 38 113 9.0E-45
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 31 115 1.0E-44
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 31 113 1.0E-44
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 31 115 1.0E-44
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 31 113 1.0E-44
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 31 115 1.0E-44
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 31 113 1.0E-44
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 31 115 1.0E-44
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 31 113 1.0E-44
sp|P14795|RL40_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi GN=FUS1 PE=2 SV=2 38 114 1.0E-44
sp|P49633|RL40_ACACA Ubiquitin-60S ribosomal protein L40 OS=Acanthamoeba castellanii PE=2 SV=2 38 114 1.0E-44
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 22 115 1.0E-44
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 38 115 2.0E-44
sp|Q3E7K8|UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana GN=UBQ12 PE=3 SV=1 13 114 2.0E-44
sp|Q9FHQ6|UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana GN=UBQ9 PE=3 SV=1 34 115 2.0E-44
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 22 115 2.0E-44
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 22 115 2.0E-44
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 22 115 2.0E-44
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 22 115 2.0E-44
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 22 113 2.0E-44
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 22 115 2.0E-44
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 22 115 2.0E-44
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 22 115 2.0E-44
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 22 115 2.0E-44
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 22 113 2.0E-44
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 22 115 2.0E-44
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 22 115 2.0E-44
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 22 115 2.0E-44
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 22 115 2.0E-44
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 22 113 2.0E-44
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 22 115 2.0E-44
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 22 115 2.0E-44
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 22 115 2.0E-44
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 22 115 2.0E-44
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 22 113 2.0E-44
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 31 115 2.0E-44
sp|Q8SWD4|UBIQ_ENCCU Ubiquitin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0740i PE=1 SV=1 38 113 2.0E-44
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 31 114 2.0E-44
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 31 115 3.0E-44
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 31 125 3.0E-44
sp|P0DJ25|RL40_TETTS Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena thermophila (strain SB210) GN=RPL40 PE=1 SV=1 38 114 3.0E-44
sp|P33190|RL40_TETPY Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena pyriformis GN=TUF11 PE=3 SV=2 38 114 3.0E-44
sp|P0C032|RUB3_ORYSJ Ubiquitin-like protein-NEDD8-like protein RUB3 OS=Oryza sativa subsp. japonica GN=RUB3 PE=3 SV=2 38 113 3.0E-44
sp|P0CG72|UBI4P_SCHPO Polyubiquitin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi4 PE=1 SV=1 38 115 4.0E-44
sp|P0CG63|UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBI4 PE=1 SV=1 38 115 4.0E-44
sp|P0CG75|UBI4P_KLULA Polyubiquitin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi4 PE=1 SV=1 38 115 4.0E-44
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 31 113 4.0E-44
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 31 115 4.0E-44
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 31 115 4.0E-44
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 31 115 4.0E-44
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 31 115 4.0E-44
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 31 115 4.0E-44
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 31 115 4.0E-44
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 31 115 4.0E-44
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 31 115 4.0E-44
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 31 115 4.0E-44
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 31 115 4.0E-44
sp|P0CG88|UBIQJ_DICDI Polyubiquitin-J OS=Dictyostelium discoideum GN=ubqJ PE=1 SV=1 22 115 4.0E-44
sp|P0CG88|UBIQJ_DICDI Polyubiquitin-J OS=Dictyostelium discoideum GN=ubqJ PE=1 SV=1 22 115 4.0E-44
sp|P0CG80|UBIQI_DICDI Polyubiquitin-I OS=Dictyostelium discoideum GN=ubqI PE=1 SV=1 22 115 4.0E-44
sp|P0CG80|UBIQI_DICDI Polyubiquitin-I OS=Dictyostelium discoideum GN=ubqI PE=1 SV=1 22 115 4.0E-44
sp|P0C276|RL40_SHEEP Ubiquitin-60S ribosomal protein L40 OS=Ovis aries GN=UBA52 PE=2 SV=2 38 113 4.0E-44
sp|P62986|RL40_RAT Ubiquitin-60S ribosomal protein L40 OS=Rattus norvegicus GN=Uba52 PE=1 SV=2 38 113 4.0E-44
sp|P0C275|RL40_PONPY Ubiquitin-60S ribosomal protein L40 OS=Pongo pygmaeus GN=UBA52 PE=2 SV=2 38 113 4.0E-44
sp|P63053|RL40_PIG Ubiquitin-60S ribosomal protein L40 OS=Sus scrofa GN=UBA52 PE=1 SV=2 38 113 4.0E-44
sp|P68205|RL40_OPHHA Ubiquitin-60S ribosomal protein L40 OS=Ophiophagus hannah PE=2 SV=2 38 113 4.0E-44
sp|P62984|RL40_MOUSE Ubiquitin-60S ribosomal protein L40 OS=Mus musculus GN=Uba52 PE=1 SV=2 38 113 4.0E-44
sp|P0C273|RL40_MACFA Ubiquitin-60S ribosomal protein L40 OS=Macaca fascicularis GN=UBA52 PE=2 SV=2 38 113 4.0E-44
sp|P62987|RL40_HUMAN Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens GN=UBA52 PE=1 SV=2 38 113 4.0E-44
sp|P63052|RL40_FELCA Ubiquitin-60S ribosomal protein L40 OS=Felis catus GN=UBA52 PE=2 SV=2 38 113 4.0E-44
sp|P63050|RL40_CANLF Ubiquitin-60S ribosomal protein L40 OS=Canis lupus familiaris GN=UBA52 PE=2 SV=2 38 113 4.0E-44
sp|P63048|RL40_BOVIN Ubiquitin-60S ribosomal protein L40 OS=Bos taurus GN=UBA52 PE=1 SV=2 38 113 4.0E-44
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 38 115 5.0E-44
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 38 115 5.0E-44
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 31 115 5.0E-44
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 31 115 5.0E-44
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 31 113 5.0E-44
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 31 113 5.0E-44
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 31 113 5.0E-44
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 31 113 5.0E-44
sp|P0CG88|UBIQJ_DICDI Polyubiquitin-J OS=Dictyostelium discoideum GN=ubqJ PE=1 SV=1 22 113 5.0E-44
sp|P0CG80|UBIQI_DICDI Polyubiquitin-I OS=Dictyostelium discoideum GN=ubqI PE=1 SV=1 22 113 5.0E-44
sp|P18101|RL40_DROME Ubiquitin-60S ribosomal protein L40 OS=Drosophila melanogaster GN=RpL40 PE=1 SV=2 38 113 5.0E-44
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 38 115 6.0E-44
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 38 115 6.0E-44
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 38 115 6.0E-44
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 22 115 6.0E-44
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 22 115 6.0E-44
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 31 115 6.0E-44
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 31 115 6.0E-44
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 31 115 6.0E-44
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 31 115 6.0E-44
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 31 115 7.0E-44
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 22 113 7.0E-44
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 31 113 7.0E-44
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 31 115 7.0E-44
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 31 113 7.0E-44
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 31 115 8.0E-44
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 31 113 8.0E-44
sp|P0CG82|UBIQP_TETPY Polyubiquitin OS=Tetrahymena pyriformis GN=TU20 PE=3 SV=1 22 115 9.0E-44
sp|P0CG82|UBIQP_TETPY Polyubiquitin OS=Tetrahymena pyriformis GN=TU20 PE=3 SV=1 22 115 9.0E-44
sp|P0CG82|UBIQP_TETPY Polyubiquitin OS=Tetrahymena pyriformis GN=TU20 PE=3 SV=1 22 115 9.0E-44
sp|P14794|RL40_DICDI Ubiquitin-60S ribosomal protein L40 OS=Dictyostelium discoideum GN=ubqB PE=1 SV=2 38 113 9.0E-44
sp|P0CG82|UBIQP_TETPY Polyubiquitin OS=Tetrahymena pyriformis GN=TU20 PE=3 SV=1 22 113 1.0E-43
sp|P21899|RL40_TRYBB Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma brucei brucei PE=1 SV=2 38 114 1.0E-43
sp|P0CH27|RL402_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi PE=2 SV=1 22 114 1.0E-43
sp|P0CH27|RL402_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi PE=2 SV=1 22 115 1.0E-43
sp|P0CH27|RL402_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi PE=2 SV=1 22 115 1.0E-43
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 22 115 2.0E-43
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 31 115 2.0E-43
sp|P46575|RL40_EIMBO Ubiquitin-60S ribosomal protein L40 OS=Eimeria bovis PE=2 SV=2 38 113 2.0E-43
sp|P0CG79|UBIQG_DICDI Polyubiquitin-G OS=Dictyostelium discoideum GN=ubqG PE=1 SV=1 22 115 2.0E-43
sp|P0CG79|UBIQG_DICDI Polyubiquitin-G OS=Dictyostelium discoideum GN=ubqG PE=1 SV=1 22 115 2.0E-43
sp|P0CG79|UBIQG_DICDI Polyubiquitin-G OS=Dictyostelium discoideum GN=ubqG PE=1 SV=1 22 115 2.0E-43
sp|P0CG79|UBIQG_DICDI Polyubiquitin-G OS=Dictyostelium discoideum GN=ubqG PE=1 SV=1 22 113 2.0E-43
sp|P69201|RL40_LEIMA Ubiquitin-60S ribosomal protein L40 OS=Leishmania major GN=UB-EP52 PE=3 SV=2 38 114 2.0E-43
sp|P0CG76|UBIQA_DICDI Polyubiquitin-A OS=Dictyostelium discoideum GN=ubqA PE=1 SV=1 22 115 2.0E-43
sp|P0CG76|UBIQA_DICDI Polyubiquitin-A OS=Dictyostelium discoideum GN=ubqA PE=1 SV=1 22 115 2.0E-43
sp|P0CG76|UBIQA_DICDI Polyubiquitin-A OS=Dictyostelium discoideum GN=ubqA PE=1 SV=1 22 115 2.0E-43
sp|P0CG81|UBIQH_DICDI Polyubiquitin-H OS=Dictyostelium discoideum GN=ubqH PE=1 SV=1 22 115 2.0E-43
sp|P0CG81|UBIQH_DICDI Polyubiquitin-H OS=Dictyostelium discoideum GN=ubqH PE=1 SV=1 22 115 2.0E-43
sp|P0CG81|UBIQH_DICDI Polyubiquitin-H OS=Dictyostelium discoideum GN=ubqH PE=1 SV=1 22 115 2.0E-43
sp|P0CH32|UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana GN=UBQ4 PE=1 SV=1 38 115 3.0E-43
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 38 115 3.0E-43
sp|P69322|UBIQP_PEA Polyubiquitin OS=Pisum sativum GN=PU1 PE=2 SV=2 38 115 3.0E-43
sp|P0CG76|UBIQA_DICDI Polyubiquitin-A OS=Dictyostelium discoideum GN=ubqA PE=1 SV=1 22 113 3.0E-43
sp|P0CG77|UBIQD_DICDI Polyubiquitin-D OS=Dictyostelium discoideum GN=ubqD PE=1 SV=1 38 115 4.0E-43
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 38 115 5.0E-43
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 38 115 5.0E-43
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 38 115 5.0E-43
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 38 115 5.0E-43
sp|P0CG81|UBIQH_DICDI Polyubiquitin-H OS=Dictyostelium discoideum GN=ubqH PE=1 SV=1 22 113 7.0E-43
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 38 115 9.0E-43
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 38 115 9.0E-43
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 38 115 9.0E-43
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 38 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 113 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 115 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 115 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 115 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 115 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 115 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 113 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 115 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 115 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 115 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 115 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 115 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 113 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 114 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|Q58G87|UBQ3_ORYSJ Polyubiquitin 3 OS=Oryza sativa subsp. japonica GN=UBQ3 PE=2 SV=2 38 115 2.0E-42
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 31 115 2.0E-42
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 38 115 2.0E-42
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 38 115 2.0E-42
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 38 115 2.0E-42
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 38 115 2.0E-42
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 38 115 2.0E-42
sp|P0CG88|UBIQJ_DICDI Polyubiquitin-J OS=Dictyostelium discoideum GN=ubqJ PE=1 SV=1 38 115 2.0E-42
sp|P0CG80|UBIQI_DICDI Polyubiquitin-I OS=Dictyostelium discoideum GN=ubqI PE=1 SV=1 38 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 114 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 114 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 38 115 3.0E-42
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 38 115 3.0E-42
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 38 115 3.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 140 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 114 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 114 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG82|UBIQP_TETPY Polyubiquitin OS=Tetrahymena pyriformis GN=TU20 PE=3 SV=1 38 115 5.0E-42
sp|P0CH27|RL402_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi PE=2 SV=1 38 115 5.0E-42
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 5.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 5.0E-42
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 38 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 7.0E-42
sp|P0CG79|UBIQG_DICDI Polyubiquitin-G OS=Dictyostelium discoideum GN=ubqG PE=1 SV=1 38 115 1.0E-41
sp|P0CG76|UBIQA_DICDI Polyubiquitin-A OS=Dictyostelium discoideum GN=ubqA PE=1 SV=1 38 115 1.0E-41
sp|P0CG81|UBIQH_DICDI Polyubiquitin-H OS=Dictyostelium discoideum GN=ubqH PE=1 SV=1 38 115 1.0E-41
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 38 115 2.0E-41
sp|P69200|RL40_LEITA Ubiquitin-60S ribosomal protein L40 OS=Leishmania tarentolae GN=UB-EP52 PE=3 SV=2 38 114 2.0E-41
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 38 115 4.0E-41
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 38 115 6.0E-41
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 38 115 6.0E-41
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 38 115 9.0E-41
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 38 115 1.0E-40
sp|Q9FHQ6|UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana GN=UBQ9 PE=3 SV=1 22 115 2.0E-40
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 38 115 2.0E-40
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 38 115 2.0E-40
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 38 115 2.0E-40
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 38 115 2.0E-40
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 38 115 2.0E-40
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 38 115 3.0E-40
sp|P0CG84|UBI4P_NICSY Polyubiquitin (Fragment) OS=Nicotiana sylvestris GN=UBI4 PE=2 SV=1 42 115 6.0E-40
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 38 115 7.0E-40
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 22 115 1.0E-38
sp|Q3E7K8|UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana GN=UBQ12 PE=3 SV=1 38 115 3.0E-38
sp|Q9FHQ6|UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana GN=UBQ9 PE=3 SV=1 36 113 9.0E-38
sp|Q05120|UBIL_NPVOP Ubiquitin-like protein OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=V-UBI PE=3 SV=1 38 120 1.0E-36
sp|P16709|UBIL_NPVAC Ubiquitin-like protein OS=Autographa californica nuclear polyhedrosis virus GN=V-UBI PE=3 SV=2 38 113 3.0E-35
sp|P84589|UBIQ_LUMTE Ubiquitin (Fragment) OS=Lumbricus terrestris PE=1 SV=2 49 111 9.0E-35
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 38 115 1.0E-33
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 26 111 2.0E-31
sp|Q9FHQ6|UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana GN=UBQ9 PE=3 SV=1 38 115 1.0E-30
sp|P23398|UBIQP_STRPU Polyubiquitin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=2 58 115 3.0E-30
sp|P0C073|RUB1_DESAN Ubiquitin-NEDD8-like protein RUB1 OS=Deschampsia antarctica GN=RUB1 PE=2 SV=2 31 113 7.0E-26
sp|P0C030|RUB1_ORYSJ Ubiquitin-NEDD8-like protein RUB1 OS=Oryza sativa subsp. japonica GN=RUB1 PE=2 SV=2 22 113 9.0E-26
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 31 113 1.0E-25
sp|Q9SHE7|RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana GN=RUB1 PE=1 SV=3 22 113 1.0E-25
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 22 115 1.0E-25
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 34 115 7.0E-25
sp|Q8RUC6|RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana GN=RUB2 PE=1 SV=3 31 113 2.0E-24
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 13 123 2.0E-24
sp|Q9VJ33|NEDD8_DROME NEDD8 OS=Drosophila melanogaster GN=Nedd8 PE=1 SV=1 38 113 3.0E-24
sp|P0C032|RUB3_ORYSJ Ubiquitin-like protein-NEDD8-like protein RUB3 OS=Oryza sativa subsp. japonica GN=RUB3 PE=3 SV=2 22 113 9.0E-24
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 36 112 1.0E-23
sp|Q93725|NEDD8_CAEEL NEDD8 OS=Caenorhabditis elegans GN=ned-8 PE=1 SV=1 38 113 1.0E-23
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 26 115 2.0E-23
sp|Q4PLJ0|NEDD8_RABIT NEDD8 OS=Oryctolagus cuniculus GN=NEDD8 PE=3 SV=1 38 118 1.0E-22
sp|Q15843|NEDD8_HUMAN NEDD8 OS=Homo sapiens GN=NEDD8 PE=1 SV=1 38 118 1.0E-22
sp|P61282|NEDD8_BOVIN NEDD8 OS=Bos taurus GN=NEDD8 PE=3 SV=1 38 118 1.0E-22
sp|O65381|RUB3_ARATH NEDD8-like protein RUB3 OS=Arabidopsis thaliana GN=RUB3 PE=2 SV=1 38 113 7.0E-22
sp|Q54XV3|NEDD8_DICDI NEDD8 OS=Dictyostelium discoideum GN=nedd8 PE=3 SV=2 38 113 2.0E-21
sp|O14399|UBL1_SCHPO Ubiquitin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubl1 PE=3 SV=1 38 114 3.0E-21
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 73 115 6.0E-20
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 73 115 2.0E-19
sp|Q03919|RUB1_YEAST NEDD8-like protein RUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RUB1 PE=1 SV=1 38 113 2.0E-19
sp|Q71UE8|NEDD8_RAT NEDD8 OS=Rattus norvegicus GN=Nedd8 PE=1 SV=1 38 105 2.0E-17
sp|P29595|NEDD8_MOUSE NEDD8 OS=Mus musculus GN=Nedd8 PE=1 SV=2 38 105 2.0E-17
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 22 73 2.0E-15
sp|D3Z3C6|ZFAN4_MOUSE AN1-type zinc finger protein 4 OS=Mus musculus GN=Zfand4 PE=3 SV=2 38 119 1.0E-12
sp|B2KIK3|UBL4A_RHIFE Ubiquitin-like protein 4A OS=Rhinolophus ferrumequinum GN=UBL4A PE=3 SV=1 38 109 2.0E-11
sp|Q86XD8|ZFAN4_HUMAN AN1-type zinc finger protein 4 OS=Homo sapiens GN=ZFAND4 PE=2 SV=2 38 113 2.0E-11
sp|P21126|UBL4A_MOUSE Ubiquitin-like protein 4A OS=Mus musculus GN=Ubl4a PE=1 SV=1 38 109 2.0E-11
sp|B2GV38|UBL4A_RAT Ubiquitin-like protein 4A OS=Rattus norvegicus GN=Ubl4a PE=2 SV=1 38 109 2.0E-11
sp|B1MTV8|UBL4A_CALMO Ubiquitin-like protein 4A OS=Callicebus moloch GN=UBL4A PE=3 SV=1 38 117 5.0E-11
sp|Q5R4T1|UBL4A_PONAB Ubiquitin-like protein 4A OS=Pongo abelii GN=UBL4A PE=2 SV=1 38 109 5.0E-11
sp|B7NZQ9|UBL4A_RABIT Ubiquitin-like protein 4A OS=Oryctolagus cuniculus GN=UBL4A PE=3 SV=1 38 109 5.0E-11
sp|P11441|UBL4A_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens GN=UBL4A PE=1 SV=1 38 109 6.0E-11
sp|B0KWT6|UBL4A_CALJA Ubiquitin-like protein 4A OS=Callithrix jacchus GN=UBL4A PE=3 SV=1 38 109 6.0E-11
sp|Q9SU29|UPL5_ARATH E3 ubiquitin-protein ligase UPL5 OS=Arabidopsis thaliana GN=UPL5 PE=1 SV=1 37 111 1.0E-10
sp|C1BXU5|UBL4A_ESOLU Ubiquitin-like protein 4A OS=Esox lucius GN=ubl4a PE=2 SV=1 38 112 2.0E-10
sp|Q09557|YQX1_CAEEL Probable ribosomal protein F34H10.1 OS=Caenorhabditis elegans GN=F34H10.1 PE=3 SV=1 77 154 1.0E-09
sp|C3KHF2|UBL4A_ANOFI Ubiquitin-like protein 4A OS=Anoplopoma fimbria GN=ubl4a PE=2 SV=1 38 109 1.0E-09
sp|B5XFI8|UB4AA_SALSA Ubiquitin-like protein 4A-A OS=Salmo salar GN=ubl4aa PE=2 SV=1 38 112 2.0E-09
sp|Q7ZWB2|UBL4A_DANRE Ubiquitin-like protein 4A OS=Danio rerio GN=ubl4a PE=2 SV=1 38 112 3.0E-09
sp|Q0D261|UBL4A_XENLA Ubiquitin-like protein 4A OS=Xenopus laevis GN=ubl4a PE=2 SV=1 38 109 3.0E-09
sp|C1BGZ8|UB4AA_ONCMY Ubiquitin-like protein 4A-A OS=Oncorhynchus mykiss GN=ubl4aa PE=2 SV=1 38 112 4.0E-09
sp|A4QND0|UBL4A_XENTR Ubiquitin-like protein 4A OS=Xenopus tropicalis GN=ubl4a PE=2 SV=1 38 109 6.0E-09
sp|B5X9S9|UB4AB_SALSA Ubiquitin-like protein 4A-B OS=Salmo salar GN=ubl4ab PE=2 SV=1 38 112 6.0E-09
sp|P62865|UBIM_BOVIN Ubiquitin-like protein FUBI OS=Bos taurus GN=FAU PE=3 SV=1 38 113 8.0E-09
sp|C1BHN7|UB4AB_ONCMY Ubiquitin-like protein 4A-B OS=Oncorhynchus mykiss GN=ubl4ab PE=2 SV=1 38 112 1.0E-08
sp|Q9JK66|PRKN2_RAT E3 ubiquitin-protein ligase parkin OS=Rattus norvegicus GN=Park2 PE=1 SV=1 38 109 1.0E-08
sp|P0C2F1|UBIM_PONAB Ubiquitin-like protein FUBI OS=Pongo abelii GN=FAU PE=3 SV=1 38 113 2.0E-08
sp|O60260|PRKN2_HUMAN E3 ubiquitin-protein ligase parkin OS=Homo sapiens GN=PARK2 PE=1 SV=2 38 109 2.0E-08
sp|Q9WVS6|PRKN2_MOUSE E3 ubiquitin-protein ligase parkin OS=Mus musculus GN=Park2 PE=1 SV=1 38 111 2.0E-08
sp|P05161|ISG15_HUMAN Ubiquitin-like protein ISG15 OS=Homo sapiens GN=ISG15 PE=1 SV=5 34 114 3.0E-08
sp|Q05474|UBIM_RAT Ubiquitin-like protein FUBI OS=Rattus norvegicus GN=Fau PE=3 SV=1 38 113 5.0E-08
sp|Q9YHD3|BAG6A_XENLA Large proline-rich protein bag6-A OS=Xenopus laevis GN=Bag6-a PE=2 SV=1 37 109 6.0E-08
sp|P55812|UBIM_PIG Ubiquitin-like protein FUBI OS=Sus scrofa GN=FAU PE=3 SV=1 38 113 7.0E-08
sp|Q60435|UBIM_CRIGR Ubiquitin-like protein FUBI OS=Cricetulus griseus GN=FAU PE=3 SV=2 38 113 1.0E-07
sp|P62868|UBIM_MUSSI Ubiquitin-like protein FUBI OS=Mus spicilegus GN=Fau PE=3 SV=1 38 113 2.0E-07
sp|P35545|UBIM_MOUSE Ubiquitin-like protein FUBI OS=Mus musculus GN=Fau PE=1 SV=1 38 113 2.0E-07
sp|P35544|UBIM_HUMAN Ubiquitin-like protein FUBI OS=Homo sapiens GN=FAU PE=1 SV=1 38 113 2.0E-07
sp|Q19KS6|UBL4B_MONDO Ubiquitin-like protein 4B OS=Monodelphis domestica GN=UBL4B PE=2 SV=1 38 109 2.0E-07
sp|Q6PA26|BAG6B_XENLA Large proline-rich protein bag6-B OS=Xenopus laevis GN=Bag6-b PE=2 SV=1 37 109 3.0E-07
sp|A7E320|UHRF1_BOVIN E3 ubiquitin-protein ligase UHRF1 OS=Bos taurus GN=UHRF1 PE=2 SV=1 38 124 3.0E-07
sp|A4IH17|BAG6_XENTR Large proline-rich protein bag6 OS=Xenopus tropicalis GN=Bag6 PE=2 SV=1 38 109 4.0E-07
sp|A7X5R6|BAG6_ORNAN Large proline-rich protein BAG6 OS=Ornithorhynchus anatinus GN=BAG6 PE=3 SV=1 38 109 4.0E-07
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 38 109 5.0E-07
sp|Q84L30|RD23D_ARATH Ubiquitin receptor RAD23d OS=Arabidopsis thaliana GN=RAD23D PE=1 SV=2 38 108 7.0E-07
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 38 109 8.0E-07
sp|Q9ZPY9|P4KG4_ARATH Phosphatidylinositol 4-kinase gamma 4 OS=Arabidopsis thaliana GN=PI4KG4 PE=1 SV=1 44 110 9.0E-07
sp|Q15459|SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens GN=SF3A1 PE=1 SV=1 45 116 1.0E-06
sp|A2VDN6|SF3A1_BOVIN Splicing factor 3A subunit 1 OS=Bos taurus GN=SF3A1 PE=2 SV=1 45 116 1.0E-06
sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 38 109 1.0E-06
sp|O15205|UBD_HUMAN Ubiquitin D OS=Homo sapiens GN=UBD PE=1 SV=2 52 113 1.0E-06
sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=1 SV=2 38 109 1.0E-06
sp|Q64339|ISG15_MOUSE Ubiquitin-like protein ISG15 OS=Mus musculus GN=Isg15 PE=1 SV=4 34 114 2.0E-06
sp|Q2T9Q2|UBL4B_BOVIN Ubiquitin-like protein 4B OS=Bos taurus GN=UBL4B PE=2 SV=1 38 109 2.0E-06
sp|Q40742|RAD23_ORYSJ Probable ubiquitin receptor RAD23 OS=Oryza sativa subsp. japonica GN=RAD23 PE=1 SV=2 38 127 2.0E-06
sp|Q8K4Z5|SF3A1_MOUSE Splicing factor 3A subunit 1 OS=Mus musculus GN=Sf3a1 PE=1 SV=1 45 116 2.0E-06
sp|Q91WB7|UBTD1_MOUSE Ubiquitin domain-containing protein 1 OS=Mus musculus GN=Ubtd1 PE=2 SV=1 34 108 2.0E-06
sp|Q68FV8|UBTD1_RAT Ubiquitin domain-containing protein 1 OS=Rattus norvegicus GN=Ubtd1 PE=2 SV=1 34 108 3.0E-06
sp|Q921A3|UBD_RAT Ubiquitin D OS=Rattus norvegicus GN=Ubd PE=1 SV=1 47 113 3.0E-06
sp|Q9NIF3|UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum GN=ubqln PE=1 SV=1 40 121 3.0E-06
sp|A3KPW9|BAG6_DANRE Large proline-rich protein BAG6 OS=Danio rerio GN=Bag6 PE=3 SV=1 36 109 4.0E-06
sp|Q3ZBQ1|UBTD1_BOVIN Ubiquitin domain-containing protein 1 OS=Bos taurus GN=UBTD1 PE=2 SV=1 34 108 4.0E-06
sp|Q9HAC8|UBTD1_HUMAN Ubiquitin domain-containing protein 1 OS=Homo sapiens GN=UBTD1 PE=1 SV=1 34 108 4.0E-06
sp|Q8N7F7|UBL4B_HUMAN Ubiquitin-like protein 4B OS=Homo sapiens GN=UBL4B PE=1 SV=1 38 157 4.0E-06
sp|Q4V8W7|UBTD1_DANRE Ubiquitin domain-containing protein 1 OS=Danio rerio GN=ubtd1 PE=2 SV=1 37 108 6.0E-06
sp|Q9CQ84|UBL4B_MOUSE Ubiquitin-like protein 4B OS=Mus musculus GN=Ubl4b PE=2 SV=1 38 164 7.0E-06
sp|Q54L35|NED82_DICDI NEDD8-like protein 2 OS=Dictyostelium discoideum GN=nedd8l2 PE=3 SV=1 46 108 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0005515 protein binding Yes
GO:0006412 translation Yes
GO:0044237 cellular metabolic process No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0044267 cellular protein metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:1990904 ribonucleoprotein complex No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4210
MGNPRSCDPPSSEPAEAPPQISLQTATPPELVYCRGKMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP
DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVDKDGN
IERLRRECPSDTCGAGVFMASMPDRQYCGRCHLTYVFDKQ*
Coding >Hirsu2|4210
ATGGGAAACCCTAGGTCATGTGACCCACCCTCGTCTGAGCCCGCCGAGGCCCCTCCCCAAATTTCGCTGCAAACC
GCCACTCCACCCGAGCTGGTCTATTGTCGAGGCAAGATGCAGATCTTCGTCAAGACCCTCACGGGGAAGACGATC
ACCCTTGAGGTGGAGTCTTCCGACACCATCGACAACGTCAAGTCCAAGATCCAGGACAAGGAGGGCATCCCGCCG
GACCAGCAGCGCCTGATCTTCGCCGGCAAGCAGCTCGAGGATGGCCGCACCCTGAGCGACTACAACATCCAGAAG
GAGAGCACCCTGCACCTGGTGCTGCGCCTGCGCGGTGGTGCCAAGAAGCGCAAGAAGAAGGTCTACACCACGCCC
AAGAAGATCAAGCACAAGCGCAAGAAGACCAAGCTGGCCGTGCTCAAGTACTACAAGGTCGACAAGGACGGCAAC
ATCGAGCGTCTGCGACGCGAGTGCCCCAGCGACACCTGCGGTGCCGGTGTCTTCATGGCCTCCATGCCCGACCGC
CAGTACTGTGGCCGTTGCCACCTGACCTACGTCTTTGACAAGCAATAA
Transcript >Hirsu2|4210
ATGGGAAACCCTAGGTCATGTGACCCACCCTCGTCTGAGCCCGCCGAGGCCCCTCCCCAAATTTCGCTGCAAACC
GCCACTCCACCCGAGCTGGTCTATTGTCGAGGCAAGATGCAGATCTTCGTCAAGACCCTCACGGGGAAGACGATC
ACCCTTGAGGTGGAGTCTTCCGACACCATCGACAACGTCAAGTCCAAGATCCAGGACAAGGAGGGCATCCCGCCG
GACCAGCAGCGCCTGATCTTCGCCGGCAAGCAGCTCGAGGATGGCCGCACCCTGAGCGACTACAACATCCAGAAG
GAGAGCACCCTGCACCTGGTGCTGCGCCTGCGCGGTGGTGCCAAGAAGCGCAAGAAGAAGGTCTACACCACGCCC
AAGAAGATCAAGCACAAGCGCAAGAAGACCAAGCTGGCCGTGCTCAAGTACTACAAGGTCGACAAGGACGGCAAC
ATCGAGCGTCTGCGACGCGAGTGCCCCAGCGACACCTGCGGTGCCGGTGTCTTCATGGCCTCCATGCCCGACCGC
CAGTACTGTGGCCGTTGCCACCTGACCTACGTCTTTGACAAGCAATAA
Gene >Hirsu2|4210
ATGGGAAACCCTAGGTCATGTGACCCACCCTCGTCTGAGCCCGCCGAGGCCCCTCCCCAAATTTCGCTGCAAACC
GCCACTCCACCCGAGCTGGTCCTTTTTTCCCCTTCAACCGCAACATCTGAGGATTGCTTAGGACGGCAATAGGTC
TATTGTCGAGGTATGTCTGAAAGATGTCGCGTTTCTCTGCCTTGCCCCCTTGAGACCCTCTCTTCGGCCTCCGCG
TCACCTCCCATTTTCTTGCCCGGGATTTTCTCGAGGCCGACGCCTCCTGCCGTCGCTGCATTGTGTCGCAGGATG
GCCGGCTCGGCGAGAACTCCCGGACGGCGGCGATGTTGTGTCTAACTCTGGCGGCCAGGCAAGATGCAGATCTTC
GTCAAGACCCTCACGGGGAAGACGATCACCCTTGAGGTGGAGTCTTCCGACACCATCGACAACGTCAAGTCCAAG
ATCCAGGACAAGGAGGGCATCCCGCCGGACCAGCAGCGCCTGATCTTCGCCGGCAAGCAGCTCGAGGATGGCCGC
ACCCTGAGCGACTACAACATCCAGAAGGAGAGCACCCTGCACCTGGTGCTGCGCCTGCGCGGTGGTGCCAAGAAG
CGCAAGAAGAAGGTCTACACCACGCCCAAGAAGATCAAGCACAAGCGCAAGAAGACCAAGCTGGCCGTGCTCAAG
TACTACAAGGTCGACAAGGACGGCAACATCGAGCGTCTGCGACGCGAGTGCCCCAGCGACACCGTAAGCCGCCCC
CCTCTCCCGCCGCCCCCTGCGGTCAGGGTCTATCAACCGGAGATGCTAACGCGATGTCACTCGCAGTGCGGTGCC
GGTGTCTTCATGGCCTCCATGCCCGACCGCCAGTACTGTGGCCGTTGCCACCTGACCTACGTCTTTGACAAGCAA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail