Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4210
Gene name
LocationContig_217:5061..5964
Strand-
Gene length (bp)903
Transcript length (bp)573
Coding sequence length (bp)573
Protein length (aa) 191

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00240 ubiquitin Ubiquitin family 6.1E-33 40 111
PF01599 Ribosomal_S27 Ribosomal protein S27a 1.5E-24 139 184
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 6.3E-16 38 108
PF14560 Ubiquitin_2 Ubiquitin-like domain 3.4E-04 47 106

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14799|RS27A_NEUCR Ubiquitin-40S ribosomal protein S27a OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi::crp-6 PE=1 SV=4 38 189 8.0E-82
sp|P62979|RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P62978|RS27A_CAVPO Ubiquitin-40S ribosomal protein S27a OS=Cavia porcellus GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P62992|RS27A_BOVIN Ubiquitin-40S ribosomal protein S27a OS=Bos taurus GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P68200|RS27A_ICTPU Ubiquitin-40S ribosomal protein S27a OS=Ictalurus punctatus GN=rps27a PE=2 SV=2 38 189 2.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14799|RS27A_NEUCR Ubiquitin-40S ribosomal protein S27a OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi::crp-6 PE=1 SV=4 38 189 8.0E-82
sp|P62979|RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P62978|RS27A_CAVPO Ubiquitin-40S ribosomal protein S27a OS=Cavia porcellus GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P62992|RS27A_BOVIN Ubiquitin-40S ribosomal protein S27a OS=Bos taurus GN=RPS27A PE=1 SV=2 38 189 8.0E-80
sp|P68200|RS27A_ICTPU Ubiquitin-40S ribosomal protein S27a OS=Ictalurus punctatus GN=rps27a PE=2 SV=2 38 189 2.0E-79
sp|P79781|RS27A_CHICK Ubiquitin-40S ribosomal protein S27a OS=Gallus gallus GN=RPS27A PE=2 SV=3 38 189 3.0E-79
sp|P15357|RS27A_DROME Ubiquitin-40S ribosomal protein S27a OS=Drosophila melanogaster GN=RpS27A PE=1 SV=2 38 189 5.0E-79
sp|P62982|RS27A_RAT Ubiquitin-40S ribosomal protein S27a OS=Rattus norvegicus GN=Rps27a PE=1 SV=2 38 189 5.0E-79
sp|P62983|RS27A_MOUSE Ubiquitin-40S ribosomal protein S27a OS=Mus musculus GN=Rps27a PE=1 SV=2 38 189 5.0E-79
sp|P68202|RS27A_PLUXY Ubiquitin-40S ribosomal protein S27a OS=Plutella xylostella PE=2 SV=2 38 187 6.0E-77
sp|P29504|RS27A_MANSE Ubiquitin-40S ribosomal protein S27a OS=Manduca sexta PE=2 SV=2 38 187 2.0E-76
sp|P68203|RS27A_SPOFR Ubiquitin-40S ribosomal protein S27a OS=Spodoptera frugiperda PE=2 SV=2 38 187 4.0E-76
sp|P59271|R27AA_ARATH Ubiquitin-40S ribosomal protein S27a-1 OS=Arabidopsis thaliana GN=RPS27AA PE=1 SV=2 38 189 1.0E-75
sp|P14797|RS27A_DICDI Ubiquitin-40S ribosomal protein S27a OS=Dictyostelium discoideum GN=ubqC PE=1 SV=2 38 186 9.0E-75
sp|P59232|R27AB_ARATH Ubiquitin-40S ribosomal protein S27a-2 OS=Arabidopsis thaliana GN=RPS27AB PE=1 SV=2 38 190 1.0E-74
sp|P59233|R27AC_ARATH Ubiquitin-40S ribosomal protein S27a-3 OS=Arabidopsis thaliana GN=RPS27AC PE=1 SV=2 38 190 2.0E-74
sp|P69061|RS27A_KLULA Ubiquitin-40S ribosomal protein S27a OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi3 PE=1 SV=2 38 189 4.0E-74
sp|P62981|RS27A_SOLTU Ubiquitin-40S ribosomal protein S27a OS=Solanum tuberosum GN=UBI3 PE=2 SV=2 38 189 4.0E-73
sp|P62980|RS27A_SOLLC Ubiquitin-40S ribosomal protein S27a OS=Solanum lycopersicum GN=UBI3 PE=3 SV=2 38 189 4.0E-73
sp|P47905|RS27A_LUPAL Ubiquitin-40S ribosomal protein S27a OS=Lupinus albus PE=3 SV=2 38 189 7.0E-72
sp|Q9ARZ9|R27AA_ORYSJ Ubiquitin-40S ribosomal protein S27a-1 OS=Oryza sativa subsp. japonica GN=RPS27AA PE=2 SV=1 38 190 2.0E-71
sp|P27923|RS27A_MAIZE Ubiquitin-40S ribosomal protein S27a OS=Zea mays GN=UBF9 PE=2 SV=2 38 190 2.0E-71
sp|P51431|R27AB_ORYSJ Ubiquitin-40S ribosomal protein S27a-2 OS=Oryza sativa subsp. japonica GN=RPS27AB PE=2 SV=3 38 190 4.0E-71
sp|P0CG87|RS272_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB2 PE=3 SV=1 38 190 1.0E-70
sp|P0CG86|RS271_HORVU Ubiquitin-40S ribosomal protein S27a OS=Hordeum vulgare GN=MUB1 PE=3 SV=1 38 190 1.0E-70
sp|P05759|RS27A_YEAST Ubiquitin-40S ribosomal protein S31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS31 PE=1 SV=3 38 185 4.0E-70
sp|P0C8R3|RS27B_SCHPO Ubiquitin-40S ribosomal protein S27b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi5 PE=1 SV=2 38 184 5.0E-67
sp|P0C016|RS27A_SCHPO Ubiquitin-40S ribosomal protein S27a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi3 PE=1 SV=2 38 184 7.0E-67
sp|P59272|RS27A_DAUCA Ubiquitin-40S ribosomal protein S27a (Fragment) OS=Daucus carota PE=2 SV=2 38 180 3.0E-64
sp|P37164|RS27A_CAEBR Ubiquitin-like protein 1-40S ribosomal protein S27a OS=Caenorhabditis briggsae GN=ubl-1 PE=1 SV=2 40 188 2.0E-48
sp|P37165|RS27A_CAEEL Ubiquitin-like protein 1-40S ribosomal protein S27a OS=Caenorhabditis elegans GN=ubl-1 PE=1 SV=2 40 188 2.0E-47
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 22 115 3.0E-47
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 22 113 3.0E-47
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 22 115 3.0E-47
sp|P0CG83|UBIQP_HORVU Polyubiquitin (Fragment) OS=Hordeum vulgare PE=2 SV=1 22 113 4.0E-47
sp|P19848|UBIQ_COPCO Ubiquitin OS=Coprinellus congregatus PE=1 SV=1 38 113 8.0E-47
sp|P0CG74|UBI4P_CANAX Polyubiquitin OS=Candida albicans GN=UBI4 PE=1 SV=1 22 115 2.0E-46
sp|P0CG74|UBI4P_CANAX Polyubiquitin OS=Candida albicans GN=UBI4 PE=1 SV=1 22 115 2.0E-46
sp|P0CG74|UBI4P_CANAX Polyubiquitin OS=Candida albicans GN=UBI4 PE=1 SV=1 22 113 2.0E-46
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 22 115 2.0E-46
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 22 113 2.0E-46
sp|P69310|UBIQ_AVESA Ubiquitin OS=Avena sativa PE=1 SV=1 38 113 2.0E-46
sp|P69326|UBIQ_WHEAT Ubiquitin OS=Triticum aestivum PE=3 SV=2 38 113 2.0E-46
sp|Q3E7K8|UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana GN=UBQ12 PE=3 SV=1 26 115 2.0E-46
sp|P69317|UBIQ_LUPPO Ubiquitin OS=Lupinus polyphyllus PE=3 SV=2 38 113 2.0E-46
sp|P69313|UBIQ_HELAN Ubiquitin OS=Helianthus annuus PE=3 SV=2 38 113 2.0E-46
sp|P40909|RL40_CRYNJ Ubiquitin-60S ribosomal protein L40 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=UBI1 PE=1 SV=2 38 113 3.0E-46
sp|P0CH07|RL402_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uep1 PE=1 SV=1 38 113 4.0E-46
sp|P0CH06|RL401_SCHPO Ubiquitin-60S ribosomal protein L40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi1 PE=1 SV=1 38 113 4.0E-46
sp|P0CH09|RL402_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40B PE=1 SV=1 38 113 4.0E-46
sp|P0CH08|RL401_YEAST Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40A PE=1 SV=1 38 113 4.0E-46
sp|P0CG72|UBI4P_SCHPO Polyubiquitin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG72|UBI4P_SCHPO Polyubiquitin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG72|UBI4P_SCHPO Polyubiquitin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG63|UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBI4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG63|UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBI4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG63|UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBI4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG75|UBI4P_KLULA Polyubiquitin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG75|UBI4P_KLULA Polyubiquitin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|P0CG75|UBI4P_KLULA Polyubiquitin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi4 PE=1 SV=1 22 115 8.0E-46
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 22 114 8.0E-46
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 22 115 9.0E-46
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 22 115 9.0E-46
sp|P0CG72|UBI4P_SCHPO Polyubiquitin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi4 PE=1 SV=1 22 113 1.0E-45
sp|P0CG63|UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBI4 PE=1 SV=1 22 113 1.0E-45
sp|P0CG75|UBI4P_KLULA Polyubiquitin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi4 PE=1 SV=1 22 113 1.0E-45
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 22 115 1.0E-45
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 22 115 1.0E-45
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 22 113 1.0E-45
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 22 115 1.0E-45
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 22 115 1.0E-45
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 22 113 1.0E-45
sp|P62972|UBIQP_XENLA Polyubiquitin (Fragment) OS=Xenopus laevis PE=1 SV=2 31 115 1.0E-45
sp|P62972|UBIQP_XENLA Polyubiquitin (Fragment) OS=Xenopus laevis PE=1 SV=2 31 113 1.0E-45
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 22 115 1.0E-45
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 22 115 1.0E-45
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 22 113 1.0E-45
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 22 115 1.0E-45
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 22 115 1.0E-45
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 22 113 1.0E-45
sp|P31753|RS27A_ASPOF Ubiquitin-40S ribosomal protein S27a (Fragment) OS=Asparagus officinalis PE=2 SV=2 74 189 1.0E-45
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 22 115 1.0E-45
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 22 115 1.0E-45
sp|P51423|RL40_BRARP Ubiquitin-60S ribosomal protein L40 OS=Brassica rapa subsp. pekinensis PE=2 SV=2 38 113 1.0E-45
sp|P0CH35|RL40B_ORYSJ Ubiquitin-60S ribosomal protein L40-2 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-2 PE=3 SV=1 38 113 2.0E-45
sp|P0CH34|RL40A_ORYSJ Ubiquitin-60S ribosomal protein L40-1 OS=Oryza sativa subsp. japonica GN=Ub-CEP52-1 PE=2 SV=1 38 113 2.0E-45
sp|Q8RUC6|RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana GN=RUB2 PE=1 SV=3 38 113 2.0E-45
sp|P23398|UBIQP_STRPU Polyubiquitin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=2 31 113 2.0E-45
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 38 113 2.0E-45
sp|P0C073|RUB1_DESAN Ubiquitin-NEDD8-like protein RUB1 OS=Deschampsia antarctica GN=RUB1 PE=2 SV=2 38 113 2.0E-45
sp|P49636|RL40_NICSY Ubiquitin-60S ribosomal protein L40 OS=Nicotiana sylvestris GN=UBICEP52-7 PE=2 SV=2 38 113 2.0E-45
sp|P0C030|RUB1_ORYSJ Ubiquitin-NEDD8-like protein RUB1 OS=Oryza sativa subsp. japonica GN=RUB1 PE=2 SV=2 38 113 2.0E-45
sp|Q42202|RL40B_ARATH Ubiquitin-60S ribosomal protein L40-2 OS=Arabidopsis thaliana GN=RPL40B PE=1 SV=2 38 113 2.0E-45
sp|B9DHA6|RL40A_ARATH Ubiquitin-60S ribosomal protein L40-1 OS=Arabidopsis thaliana GN=RPL40A PE=1 SV=1 38 113 2.0E-45
sp|P0C224|RL40_NEUCR Ubiquitin-60S ribosomal protein L40 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-79 PE=1 SV=2 38 113 2.0E-45
sp|Q9SHE7|RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana GN=RUB1 PE=1 SV=3 38 113 2.0E-45
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 22 115 3.0E-45
sp|P0CH32|UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana GN=UBQ4 PE=1 SV=1 22 114 4.0E-45
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 22 115 4.0E-45
sp|P0CH32|UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana GN=UBQ4 PE=1 SV=1 22 115 5.0E-45
sp|P0CH32|UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana GN=UBQ4 PE=1 SV=1 22 115 5.0E-45
sp|P0CH32|UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana GN=UBQ4 PE=1 SV=1 22 115 5.0E-45
sp|P0CG84|UBI4P_NICSY Polyubiquitin (Fragment) OS=Nicotiana sylvestris GN=UBI4 PE=2 SV=1 22 115 5.0E-45
sp|P0CG84|UBI4P_NICSY Polyubiquitin (Fragment) OS=Nicotiana sylvestris GN=UBI4 PE=2 SV=1 22 115 5.0E-45
sp|P0CG84|UBI4P_NICSY Polyubiquitin (Fragment) OS=Nicotiana sylvestris GN=UBI4 PE=2 SV=1 22 115 5.0E-45
sp|P69322|UBIQP_PEA Polyubiquitin OS=Pisum sativum GN=PU1 PE=2 SV=2 22 115 5.0E-45
sp|P69322|UBIQP_PEA Polyubiquitin OS=Pisum sativum GN=PU1 PE=2 SV=2 22 115 5.0E-45
sp|P69322|UBIQP_PEA Polyubiquitin OS=Pisum sativum GN=PU1 PE=2 SV=2 22 115 5.0E-45
sp|Q58G87|UBQ3_ORYSJ Polyubiquitin 3 OS=Oryza sativa subsp. japonica GN=UBQ3 PE=2 SV=2 22 115 5.0E-45
sp|Q58G87|UBQ3_ORYSJ Polyubiquitin 3 OS=Oryza sativa subsp. japonica GN=UBQ3 PE=2 SV=2 22 115 5.0E-45
sp|Q58G87|UBQ3_ORYSJ Polyubiquitin 3 OS=Oryza sativa subsp. japonica GN=UBQ3 PE=2 SV=2 22 115 5.0E-45
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 22 113 6.0E-45
sp|P0CG84|UBI4P_NICSY Polyubiquitin (Fragment) OS=Nicotiana sylvestris GN=UBI4 PE=2 SV=1 22 113 6.0E-45
sp|P69322|UBIQP_PEA Polyubiquitin OS=Pisum sativum GN=PU1 PE=2 SV=2 22 113 6.0E-45
sp|Q58G87|UBQ3_ORYSJ Polyubiquitin 3 OS=Oryza sativa subsp. japonica GN=UBQ3 PE=2 SV=2 22 113 6.0E-45
sp|P0CH10|RL403_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI3 PE=1 SV=1 38 113 6.0E-45
sp|P0CH11|RL401_CHLRE Ubiquitin-60S ribosomal protein L40 OS=Chlamydomonas reinhardtii GN=UBI1 PE=1 SV=1 38 113 6.0E-45
sp|P62975|UBIQ_RABIT Ubiquitin OS=Oryctolagus cuniculus PE=1 SV=1 38 113 7.0E-45
sp|P68197|UBIQ_CERCA Ubiquitin OS=Ceratitis capitata PE=1 SV=1 38 113 7.0E-45
sp|Q865C5|UBIQ_CAMDR Ubiquitin OS=Camelus dromedarius PE=3 SV=2 38 113 7.0E-45
sp|P0CG77|UBIQD_DICDI Polyubiquitin-D OS=Dictyostelium discoideum GN=ubqD PE=1 SV=1 22 115 8.0E-45
sp|P0CG74|UBI4P_CANAX Polyubiquitin OS=Candida albicans GN=UBI4 PE=1 SV=1 38 115 9.0E-45
sp|P0CH33|UBQ11_ARATH Polyubiquitin 11 OS=Arabidopsis thaliana GN=UBQ11 PE=1 SV=1 38 115 9.0E-45
sp|P0CG77|UBIQD_DICDI Polyubiquitin-D OS=Dictyostelium discoideum GN=ubqD PE=1 SV=1 22 113 9.0E-45
sp|P49632|RL40_CAEEL Ubiquitin-60S ribosomal protein L40 OS=Caenorhabditis elegans GN=ubq-2 PE=3 SV=2 38 113 9.0E-45
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 31 115 1.0E-44
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 31 113 1.0E-44
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 31 115 1.0E-44
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 31 113 1.0E-44
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 31 115 1.0E-44
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 31 113 1.0E-44
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 31 115 1.0E-44
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 31 113 1.0E-44
sp|P14795|RL40_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi GN=FUS1 PE=2 SV=2 38 114 1.0E-44
sp|P49633|RL40_ACACA Ubiquitin-60S ribosomal protein L40 OS=Acanthamoeba castellanii PE=2 SV=2 38 114 1.0E-44
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 22 115 1.0E-44
sp|P0CG73|UBI1P_CANAX Polyubiquitin OS=Candida albicans GN=UBI1 PE=1 SV=1 38 115 2.0E-44
sp|Q3E7K8|UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana GN=UBQ12 PE=3 SV=1 13 114 2.0E-44
sp|Q9FHQ6|UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana GN=UBQ9 PE=3 SV=1 34 115 2.0E-44
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 22 115 2.0E-44
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 22 115 2.0E-44
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 22 115 2.0E-44
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 22 115 2.0E-44
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 22 113 2.0E-44
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 22 115 2.0E-44
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 22 115 2.0E-44
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 22 115 2.0E-44
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 22 115 2.0E-44
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 22 113 2.0E-44
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 22 115 2.0E-44
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 22 115 2.0E-44
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 22 115 2.0E-44
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 22 115 2.0E-44
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 22 113 2.0E-44
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 22 115 2.0E-44
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 22 115 2.0E-44
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 22 115 2.0E-44
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 22 115 2.0E-44
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 22 113 2.0E-44
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 31 115 2.0E-44
sp|Q8SWD4|UBIQ_ENCCU Ubiquitin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0740i PE=1 SV=1 38 113 2.0E-44
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 31 114 2.0E-44
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 31 115 3.0E-44
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 31 125 3.0E-44
sp|P0DJ25|RL40_TETTS Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena thermophila (strain SB210) GN=RPL40 PE=1 SV=1 38 114 3.0E-44
sp|P33190|RL40_TETPY Ubiquitin-60S ribosomal protein L40 OS=Tetrahymena pyriformis GN=TUF11 PE=3 SV=2 38 114 3.0E-44
sp|P0C032|RUB3_ORYSJ Ubiquitin-like protein-NEDD8-like protein RUB3 OS=Oryza sativa subsp. japonica GN=RUB3 PE=3 SV=2 38 113 3.0E-44
sp|P0CG72|UBI4P_SCHPO Polyubiquitin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubi4 PE=1 SV=1 38 115 4.0E-44
sp|P0CG63|UBI4P_YEAST Polyubiquitin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBI4 PE=1 SV=1 38 115 4.0E-44
sp|P0CG75|UBI4P_KLULA Polyubiquitin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ubi4 PE=1 SV=1 38 115 4.0E-44
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 31 113 4.0E-44
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 31 115 4.0E-44
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 31 115 4.0E-44
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 31 115 4.0E-44
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 31 115 4.0E-44
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 31 115 4.0E-44
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 31 115 4.0E-44
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 31 115 4.0E-44
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 31 115 4.0E-44
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 31 115 4.0E-44
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 31 115 4.0E-44
sp|P0CG88|UBIQJ_DICDI Polyubiquitin-J OS=Dictyostelium discoideum GN=ubqJ PE=1 SV=1 22 115 4.0E-44
sp|P0CG88|UBIQJ_DICDI Polyubiquitin-J OS=Dictyostelium discoideum GN=ubqJ PE=1 SV=1 22 115 4.0E-44
sp|P0CG80|UBIQI_DICDI Polyubiquitin-I OS=Dictyostelium discoideum GN=ubqI PE=1 SV=1 22 115 4.0E-44
sp|P0CG80|UBIQI_DICDI Polyubiquitin-I OS=Dictyostelium discoideum GN=ubqI PE=1 SV=1 22 115 4.0E-44
sp|P0C276|RL40_SHEEP Ubiquitin-60S ribosomal protein L40 OS=Ovis aries GN=UBA52 PE=2 SV=2 38 113 4.0E-44
sp|P62986|RL40_RAT Ubiquitin-60S ribosomal protein L40 OS=Rattus norvegicus GN=Uba52 PE=1 SV=2 38 113 4.0E-44
sp|P0C275|RL40_PONPY Ubiquitin-60S ribosomal protein L40 OS=Pongo pygmaeus GN=UBA52 PE=2 SV=2 38 113 4.0E-44
sp|P63053|RL40_PIG Ubiquitin-60S ribosomal protein L40 OS=Sus scrofa GN=UBA52 PE=1 SV=2 38 113 4.0E-44
sp|P68205|RL40_OPHHA Ubiquitin-60S ribosomal protein L40 OS=Ophiophagus hannah PE=2 SV=2 38 113 4.0E-44
sp|P62984|RL40_MOUSE Ubiquitin-60S ribosomal protein L40 OS=Mus musculus GN=Uba52 PE=1 SV=2 38 113 4.0E-44
sp|P0C273|RL40_MACFA Ubiquitin-60S ribosomal protein L40 OS=Macaca fascicularis GN=UBA52 PE=2 SV=2 38 113 4.0E-44
sp|P62987|RL40_HUMAN Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens GN=UBA52 PE=1 SV=2 38 113 4.0E-44
sp|P63052|RL40_FELCA Ubiquitin-60S ribosomal protein L40 OS=Felis catus GN=UBA52 PE=2 SV=2 38 113 4.0E-44
sp|P63050|RL40_CANLF Ubiquitin-60S ribosomal protein L40 OS=Canis lupus familiaris GN=UBA52 PE=2 SV=2 38 113 4.0E-44
sp|P63048|RL40_BOVIN Ubiquitin-60S ribosomal protein L40 OS=Bos taurus GN=UBA52 PE=1 SV=2 38 113 4.0E-44
sp|P0CG70|UBI4P_NEUCR Polyubiquitin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ubi PE=1 SV=1 38 115 5.0E-44
sp|P69309|UBIQP_AVEFA Polyubiquitin OS=Avena fatua PE=2 SV=2 38 115 5.0E-44
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 31 115 5.0E-44
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 31 115 5.0E-44
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 31 113 5.0E-44
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 31 113 5.0E-44
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 31 113 5.0E-44
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 31 113 5.0E-44
sp|P0CG88|UBIQJ_DICDI Polyubiquitin-J OS=Dictyostelium discoideum GN=ubqJ PE=1 SV=1 22 113 5.0E-44
sp|P0CG80|UBIQI_DICDI Polyubiquitin-I OS=Dictyostelium discoideum GN=ubqI PE=1 SV=1 22 113 5.0E-44
sp|P18101|RL40_DROME Ubiquitin-60S ribosomal protein L40 OS=Drosophila melanogaster GN=RpL40 PE=1 SV=2 38 113 5.0E-44
sp|Q1EC66|UBQ3_ARATH Polyubiquitin 3 OS=Arabidopsis thaliana GN=UBQ3 PE=1 SV=1 38 115 6.0E-44
sp|Q3E7T8|UBQ14_ARATH Polyubiquitin 14 OS=Arabidopsis thaliana GN=UBQ14 PE=1 SV=2 38 115 6.0E-44
sp|P69325|UBIQP_SOYBN Polyubiquitin OS=Glycine max GN=SUBI-1 PE=2 SV=2 38 115 6.0E-44
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 22 115 6.0E-44
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 22 115 6.0E-44
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 31 115 6.0E-44
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 31 115 6.0E-44
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 31 115 6.0E-44
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 31 115 6.0E-44
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 31 115 7.0E-44
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 22 113 7.0E-44
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 31 113 7.0E-44
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 31 115 7.0E-44
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 31 113 7.0E-44
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 31 115 8.0E-44
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 31 113 8.0E-44
sp|P0CG82|UBIQP_TETPY Polyubiquitin OS=Tetrahymena pyriformis GN=TU20 PE=3 SV=1 22 115 9.0E-44
sp|P0CG82|UBIQP_TETPY Polyubiquitin OS=Tetrahymena pyriformis GN=TU20 PE=3 SV=1 22 115 9.0E-44
sp|P0CG82|UBIQP_TETPY Polyubiquitin OS=Tetrahymena pyriformis GN=TU20 PE=3 SV=1 22 115 9.0E-44
sp|P14794|RL40_DICDI Ubiquitin-60S ribosomal protein L40 OS=Dictyostelium discoideum GN=ubqB PE=1 SV=2 38 113 9.0E-44
sp|P0CG82|UBIQP_TETPY Polyubiquitin OS=Tetrahymena pyriformis GN=TU20 PE=3 SV=1 22 113 1.0E-43
sp|P21899|RL40_TRYBB Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma brucei brucei PE=1 SV=2 38 114 1.0E-43
sp|P0CH27|RL402_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi PE=2 SV=1 22 114 1.0E-43
sp|P0CH27|RL402_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi PE=2 SV=1 22 115 1.0E-43
sp|P0CH27|RL402_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi PE=2 SV=1 22 115 1.0E-43
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 22 115 2.0E-43
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 31 115 2.0E-43
sp|P46575|RL40_EIMBO Ubiquitin-60S ribosomal protein L40 OS=Eimeria bovis PE=2 SV=2 38 113 2.0E-43
sp|P0CG79|UBIQG_DICDI Polyubiquitin-G OS=Dictyostelium discoideum GN=ubqG PE=1 SV=1 22 115 2.0E-43
sp|P0CG79|UBIQG_DICDI Polyubiquitin-G OS=Dictyostelium discoideum GN=ubqG PE=1 SV=1 22 115 2.0E-43
sp|P0CG79|UBIQG_DICDI Polyubiquitin-G OS=Dictyostelium discoideum GN=ubqG PE=1 SV=1 22 115 2.0E-43
sp|P0CG79|UBIQG_DICDI Polyubiquitin-G OS=Dictyostelium discoideum GN=ubqG PE=1 SV=1 22 113 2.0E-43
sp|P69201|RL40_LEIMA Ubiquitin-60S ribosomal protein L40 OS=Leishmania major GN=UB-EP52 PE=3 SV=2 38 114 2.0E-43
sp|P0CG76|UBIQA_DICDI Polyubiquitin-A OS=Dictyostelium discoideum GN=ubqA PE=1 SV=1 22 115 2.0E-43
sp|P0CG76|UBIQA_DICDI Polyubiquitin-A OS=Dictyostelium discoideum GN=ubqA PE=1 SV=1 22 115 2.0E-43
sp|P0CG76|UBIQA_DICDI Polyubiquitin-A OS=Dictyostelium discoideum GN=ubqA PE=1 SV=1 22 115 2.0E-43
sp|P0CG81|UBIQH_DICDI Polyubiquitin-H OS=Dictyostelium discoideum GN=ubqH PE=1 SV=1 22 115 2.0E-43
sp|P0CG81|UBIQH_DICDI Polyubiquitin-H OS=Dictyostelium discoideum GN=ubqH PE=1 SV=1 22 115 2.0E-43
sp|P0CG81|UBIQH_DICDI Polyubiquitin-H OS=Dictyostelium discoideum GN=ubqH PE=1 SV=1 22 115 2.0E-43
sp|P0CH32|UBQ4_ARATH Polyubiquitin 4 OS=Arabidopsis thaliana GN=UBQ4 PE=1 SV=1 38 115 3.0E-43
sp|P23324|UBIQP_EUPEU Polyubiquitin OS=Euplotes eurystomus PE=3 SV=2 38 115 3.0E-43
sp|P69322|UBIQP_PEA Polyubiquitin OS=Pisum sativum GN=PU1 PE=2 SV=2 38 115 3.0E-43
sp|P0CG76|UBIQA_DICDI Polyubiquitin-A OS=Dictyostelium discoideum GN=ubqA PE=1 SV=1 22 113 3.0E-43
sp|P0CG77|UBIQD_DICDI Polyubiquitin-D OS=Dictyostelium discoideum GN=ubqD PE=1 SV=1 38 115 4.0E-43
sp|P0CG60|UBB_PONPY Polyubiquitin-B OS=Pongo pygmaeus GN=UBB PE=3 SV=1 38 115 5.0E-43
sp|P0CG65|UBB_PANTR Polyubiquitin-B OS=Pan troglodytes GN=UBB PE=3 SV=1 38 115 5.0E-43
sp|P0CG47|UBB_HUMAN Polyubiquitin-B OS=Homo sapiens GN=UBB PE=1 SV=1 38 115 5.0E-43
sp|P0CG67|UBB_GORGO Polyubiquitin-B OS=Gorilla gorilla gorilla GN=UBB PE=3 SV=1 38 115 5.0E-43
sp|P0CG81|UBIQH_DICDI Polyubiquitin-H OS=Dictyostelium discoideum GN=ubqH PE=1 SV=1 22 113 7.0E-43
sp|Q8H159|UBQ10_ARATH Polyubiquitin 10 OS=Arabidopsis thaliana GN=UBQ10 PE=1 SV=2 38 115 9.0E-43
sp|P0CG85|UBI1P_NICSY Polyubiquitin OS=Nicotiana sylvestris GN=UBI11 PE=2 SV=1 38 115 9.0E-43
sp|P0CH05|UBI2P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-2 PE=3 SV=1 38 115 9.0E-43
sp|P0CH04|UBI1P_PETCR Polyubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=2 SV=1 38 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 9.0E-43
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 113 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 115 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 115 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 115 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 115 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 115 1.0E-42
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 31 113 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 115 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 115 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 115 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 115 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 115 1.0E-42
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 22 113 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 114 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 31 115 1.0E-42
sp|Q58G87|UBQ3_ORYSJ Polyubiquitin 3 OS=Oryza sativa subsp. japonica GN=UBQ3 PE=2 SV=2 38 115 2.0E-42
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 31 115 2.0E-42
sp|P0CG54|UBB_CAVPO Polyubiquitin-B OS=Cavia porcellus GN=UBB PE=2 SV=1 38 115 2.0E-42
sp|P22589|UBIQP_PHYIN Polyubiquitin OS=Phytophthora infestans PE=1 SV=2 38 115 2.0E-42
sp|P0CG51|UBB_RAT Polyubiquitin-B OS=Rattus norvegicus GN=Ubb PE=1 SV=1 38 115 2.0E-42
sp|P0CG49|UBB_MOUSE Polyubiquitin-B OS=Mus musculus GN=Ubb PE=2 SV=1 38 115 2.0E-42
sp|P0CG62|UBB_CHICK Polyubiquitin-B OS=Gallus gallus GN=UBB PE=2 SV=1 38 115 2.0E-42
sp|P0CG88|UBIQJ_DICDI Polyubiquitin-J OS=Dictyostelium discoideum GN=ubqJ PE=1 SV=1 38 115 2.0E-42
sp|P0CG80|UBIQI_DICDI Polyubiquitin-I OS=Dictyostelium discoideum GN=ubqI PE=1 SV=1 38 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 114 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 114 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 31 115 2.0E-42
sp|P59669|UBIQP_GEOCY Polyubiquitin OS=Geodia cydonium PE=2 SV=2 38 115 3.0E-42
sp|P0CG53|UBB_BOVIN Polyubiquitin-B OS=Bos taurus GN=UBB PE=1 SV=1 38 115 3.0E-42
sp|Q8MKD1|UBB_HORSE Polyubiquitin-B OS=Equus caballus GN=UBB PE=2 SV=3 38 115 3.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 140 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 114 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 114 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 4.0E-42
sp|P0CG82|UBIQP_TETPY Polyubiquitin OS=Tetrahymena pyriformis GN=TU20 PE=3 SV=1 38 115 5.0E-42
sp|P0CH27|RL402_TRYCR Ubiquitin-60S ribosomal protein L40 OS=Trypanosoma cruzi PE=2 SV=1 38 115 5.0E-42
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 22 115 5.0E-42
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 31 115 5.0E-42
sp|P0CG55|UBB_SHEEP Polyubiquitin-B OS=Ovis aries GN=UBB PE=2 SV=1 38 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 31 115 6.0E-42
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 31 115 7.0E-42
sp|P0CG79|UBIQG_DICDI Polyubiquitin-G OS=Dictyostelium discoideum GN=ubqG PE=1 SV=1 38 115 1.0E-41
sp|P0CG76|UBIQA_DICDI Polyubiquitin-A OS=Dictyostelium discoideum GN=ubqA PE=1 SV=1 38 115 1.0E-41
sp|P0CG81|UBIQH_DICDI Polyubiquitin-H OS=Dictyostelium discoideum GN=ubqH PE=1 SV=1 38 115 1.0E-41
sp|P42740|UBIQP_AGLNE Polyubiquitin OS=Aglaothamnion neglectum PE=2 SV=2 38 115 2.0E-41
sp|P69200|RL40_LEITA Ubiquitin-60S ribosomal protein L40 OS=Leishmania tarentolae GN=UB-EP52 PE=3 SV=2 38 114 2.0E-41
sp|P0CG71|UBIQ1_CAEEL Polyubiquitin-A OS=Caenorhabditis elegans GN=ubq-1 PE=3 SV=1 38 115 4.0E-41
sp|P0CG78|UBIQF_DICDI Polyubiquitin-F OS=Dictyostelium discoideum GN=ubqF PE=1 SV=1 38 115 6.0E-41
sp|P0CG66|UBC_GORGO Polyubiquitin-C OS=Gorilla gorilla gorilla GN=UBC PE=3 SV=1 38 115 6.0E-41
sp|P62976|UBIQP_CRIGR Polyubiquitin OS=Cricetulus griseus PE=2 SV=2 38 115 9.0E-41
sp|P0CG48|UBC_HUMAN Polyubiquitin-C OS=Homo sapiens GN=UBC PE=1 SV=3 38 115 1.0E-40
sp|Q9FHQ6|UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana GN=UBQ9 PE=3 SV=1 22 115 2.0E-40
sp|P0CG50|UBC_MOUSE Polyubiquitin-C OS=Mus musculus GN=Ubc PE=1 SV=2 38 115 2.0E-40
sp|P0CG61|UBC_PONPY Polyubiquitin-C OS=Pongo pygmaeus GN=UBC PE=3 SV=1 38 115 2.0E-40
sp|P0CG64|UBC_PANTR Polyubiquitin-C OS=Pan troglodytes GN=UBC PE=3 SV=1 38 115 2.0E-40
sp|P0CG69|UBIQP_DROME Polyubiquitin OS=Drosophila melanogaster GN=Ubi-p63E PE=3 SV=1 38 115 2.0E-40
sp|Q63429|UBC_RAT Polyubiquitin-C OS=Rattus norvegicus GN=Ubc PE=1 SV=1 38 115 2.0E-40
sp|P0CG68|UBC_PIG Polyubiquitin-C OS=Sus scrofa GN=UBC PE=2 SV=1 38 115 3.0E-40
sp|P0CG84|UBI4P_NICSY Polyubiquitin (Fragment) OS=Nicotiana sylvestris GN=UBI4 PE=2 SV=1 42 115 6.0E-40
sp|P0CH28|UBC_BOVIN Polyubiquitin-C OS=Bos taurus GN=UBC PE=1 SV=1 38 115 7.0E-40
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 22 115 1.0E-38
sp|Q3E7K8|UBQ12_ARATH Polyubiquitin 12 OS=Arabidopsis thaliana GN=UBQ12 PE=3 SV=1 38 115 3.0E-38
sp|Q9FHQ6|UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana GN=UBQ9 PE=3 SV=1 36 113 9.0E-38
sp|Q05120|UBIL_NPVOP Ubiquitin-like protein OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=V-UBI PE=3 SV=1 38 120 1.0E-36
sp|P16709|UBIL_NPVAC Ubiquitin-like protein OS=Autographa californica nuclear polyhedrosis virus GN=V-UBI PE=3 SV=2 38 113 3.0E-35
sp|P84589|UBIQ_LUMTE Ubiquitin (Fragment) OS=Lumbricus terrestris PE=1 SV=2 49 111 9.0E-35
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 38 115 1.0E-33
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 26 111 2.0E-31
sp|Q9FHQ6|UBQ9_ARATH Polyubiquitin 9 OS=Arabidopsis thaliana GN=UBQ9 PE=3 SV=1 38 115 1.0E-30
sp|P23398|UBIQP_STRPU Polyubiquitin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=2 58 115 3.0E-30
sp|P0C073|RUB1_DESAN Ubiquitin-NEDD8-like protein RUB1 OS=Deschampsia antarctica GN=RUB1 PE=2 SV=2 31 113 7.0E-26
sp|P0C030|RUB1_ORYSJ Ubiquitin-NEDD8-like protein RUB1 OS=Oryza sativa subsp. japonica GN=RUB1 PE=2 SV=2 22 113 9.0E-26
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 31 113 1.0E-25
sp|Q9SHE7|RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana GN=RUB1 PE=1 SV=3 22 113 1.0E-25
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 22 115 1.0E-25
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 34 115 7.0E-25
sp|Q8RUC6|RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana GN=RUB2 PE=1 SV=3 31 113 2.0E-24
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 13 123 2.0E-24
sp|Q9VJ33|NEDD8_DROME NEDD8 OS=Drosophila melanogaster GN=Nedd8 PE=1 SV=1 38 113 3.0E-24
sp|P0C032|RUB3_ORYSJ Ubiquitin-like protein-NEDD8-like protein RUB3 OS=Oryza sativa subsp. japonica GN=RUB3 PE=3 SV=2 22 113 9.0E-24
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 36 112 1.0E-23
sp|Q93725|NEDD8_CAEEL NEDD8 OS=Caenorhabditis elegans GN=ned-8 PE=1 SV=1 38 113 1.0E-23
sp|Q39256|UBQ8_ARATH Polyubiquitin 8 OS=Arabidopsis thaliana GN=UBQ8 PE=3 SV=1 26 115 2.0E-23
sp|Q4PLJ0|NEDD8_RABIT NEDD8 OS=Oryctolagus cuniculus GN=NEDD8 PE=3 SV=1 38 118 1.0E-22
sp|Q15843|NEDD8_HUMAN NEDD8 OS=Homo sapiens GN=NEDD8 PE=1 SV=1 38 118 1.0E-22
sp|P61282|NEDD8_BOVIN NEDD8 OS=Bos taurus GN=NEDD8 PE=3 SV=1 38 118 1.0E-22
sp|O65381|RUB3_ARATH NEDD8-like protein RUB3 OS=Arabidopsis thaliana GN=RUB3 PE=2 SV=1 38 113 7.0E-22
sp|Q54XV3|NEDD8_DICDI NEDD8 OS=Dictyostelium discoideum GN=nedd8 PE=3 SV=2 38 113 2.0E-21
sp|O14399|UBL1_SCHPO Ubiquitin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubl1 PE=3 SV=1 38 114 3.0E-21
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 73 115 6.0E-20
sp|P42739|UBIQP_ACEPE Polyubiquitin (Fragment) OS=Acetabularia peniculus PE=3 SV=2 73 115 2.0E-19
sp|Q03919|RUB1_YEAST NEDD8-like protein RUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RUB1 PE=1 SV=1 38 113 2.0E-19
sp|Q71UE8|NEDD8_RAT NEDD8 OS=Rattus norvegicus GN=Nedd8 PE=1 SV=1 38 105 2.0E-17
sp|P29595|NEDD8_MOUSE NEDD8 OS=Mus musculus GN=Nedd8 PE=1 SV=2 38 105 2.0E-17
sp|P69315|UBIQP_LINUS Polyubiquitin (Fragment) OS=Linum usitatissimum PE=3 SV=2 22 73 2.0E-15
sp|D3Z3C6|ZFAN4_MOUSE AN1-type zinc finger protein 4 OS=Mus musculus GN=Zfand4 PE=3 SV=2 38 119 1.0E-12
sp|B2KIK3|UBL4A_RHIFE Ubiquitin-like protein 4A OS=Rhinolophus ferrumequinum GN=UBL4A PE=3 SV=1 38 109 2.0E-11
sp|Q86XD8|ZFAN4_HUMAN AN1-type zinc finger protein 4 OS=Homo sapiens GN=ZFAND4 PE=2 SV=2 38 113 2.0E-11
sp|P21126|UBL4A_MOUSE Ubiquitin-like protein 4A OS=Mus musculus GN=Ubl4a PE=1 SV=1 38 109 2.0E-11
sp|B2GV38|UBL4A_RAT Ubiquitin-like protein 4A OS=Rattus norvegicus GN=Ubl4a PE=2 SV=1 38 109 2.0E-11
sp|B1MTV8|UBL4A_CALMO Ubiquitin-like protein 4A OS=Callicebus moloch GN=UBL4A PE=3 SV=1 38 117 5.0E-11
sp|Q5R4T1|UBL4A_PONAB Ubiquitin-like protein 4A OS=Pongo abelii GN=UBL4A PE=2 SV=1 38 109 5.0E-11
sp|B7NZQ9|UBL4A_RABIT Ubiquitin-like protein 4A OS=Oryctolagus cuniculus GN=UBL4A PE=3 SV=1 38 109 5.0E-11
sp|P11441|UBL4A_HUMAN Ubiquitin-like protein 4A OS=Homo sapiens GN=UBL4A PE=1 SV=1 38 109 6.0E-11
sp|B0KWT6|UBL4A_CALJA Ubiquitin-like protein 4A OS=Callithrix jacchus GN=UBL4A PE=3 SV=1 38 109 6.0E-11
sp|Q9SU29|UPL5_ARATH E3 ubiquitin-protein ligase UPL5 OS=Arabidopsis thaliana GN=UPL5 PE=1 SV=1 37 111 1.0E-10
sp|C1BXU5|UBL4A_ESOLU Ubiquitin-like protein 4A OS=Esox lucius GN=ubl4a PE=2 SV=1 38 112 2.0E-10
sp|Q09557|YQX1_CAEEL Probable ribosomal protein F34H10.1 OS=Caenorhabditis elegans GN=F34H10.1 PE=3 SV=1 77 154 1.0E-09
sp|C3KHF2|UBL4A_ANOFI Ubiquitin-like protein 4A OS=Anoplopoma fimbria GN=ubl4a PE=2 SV=1 38 109 1.0E-09
sp|B5XFI8|UB4AA_SALSA Ubiquitin-like protein 4A-A OS=Salmo salar GN=ubl4aa PE=2 SV=1 38 112 2.0E-09
sp|Q7ZWB2|UBL4A_DANRE Ubiquitin-like protein 4A OS=Danio rerio GN=ubl4a PE=2 SV=1 38 112 3.0E-09
sp|Q0D261|UBL4A_XENLA Ubiquitin-like protein 4A OS=Xenopus laevis GN=ubl4a PE=2 SV=1 38 109 3.0E-09
sp|C1BGZ8|UB4AA_ONCMY Ubiquitin-like protein 4A-A OS=Oncorhynchus mykiss GN=ubl4aa PE=2 SV=1 38 112 4.0E-09
sp|A4QND0|UBL4A_XENTR Ubiquitin-like protein 4A OS=Xenopus tropicalis GN=ubl4a PE=2 SV=1 38 109 6.0E-09
sp|B5X9S9|UB4AB_SALSA Ubiquitin-like protein 4A-B OS=Salmo salar GN=ubl4ab PE=2 SV=1 38 112 6.0E-09
sp|P62865|UBIM_BOVIN Ubiquitin-like protein FUBI OS=Bos taurus GN=FAU PE=3 SV=1 38 113 8.0E-09
sp|C1BHN7|UB4AB_ONCMY Ubiquitin-like protein 4A-B OS=Oncorhynchus mykiss GN=ubl4ab PE=2 SV=1 38 112 1.0E-08
sp|Q9JK66|PRKN2_RAT E3 ubiquitin-protein ligase parkin OS=Rattus norvegicus GN=Park2 PE=1 SV=1 38 109 1.0E-08
sp|P0C2F1|UBIM_PONAB Ubiquitin-like protein FUBI OS=Pongo abelii GN=FAU PE=3 SV=1 38 113 2.0E-08
sp|O60260|PRKN2_HUMAN E3 ubiquitin-protein ligase parkin OS=Homo sapiens GN=PARK2 PE=1 SV=2 38 109 2.0E-08
sp|Q9WVS6|PRKN2_MOUSE E3 ubiquitin-protein ligase parkin OS=Mus musculus GN=Park2 PE=1 SV=1 38 111 2.0E-08
sp|P05161|ISG15_HUMAN Ubiquitin-like protein ISG15 OS=Homo sapiens GN=ISG15 PE=1 SV=5 34 114 3.0E-08
sp|Q05474|UBIM_RAT Ubiquitin-like protein FUBI OS=Rattus norvegicus GN=Fau PE=3 SV=1 38 113 5.0E-08
sp|Q9YHD3|BAG6A_XENLA Large proline-rich protein bag6-A OS=Xenopus laevis GN=Bag6-a PE=2 SV=1 37 109 6.0E-08
sp|P55812|UBIM_PIG Ubiquitin-like protein FUBI OS=Sus scrofa GN=FAU PE=3 SV=1 38 113 7.0E-08
sp|Q60435|UBIM_CRIGR Ubiquitin-like protein FUBI OS=Cricetulus griseus GN=FAU PE=3 SV=2 38 113 1.0E-07
sp|P62868|UBIM_MUSSI Ubiquitin-like protein FUBI OS=Mus spicilegus GN=Fau PE=3 SV=1 38 113 2.0E-07
sp|P35545|UBIM_MOUSE Ubiquitin-like protein FUBI OS=Mus musculus GN=Fau PE=1 SV=1 38 113 2.0E-07
sp|P35544|UBIM_HUMAN Ubiquitin-like protein FUBI OS=Homo sapiens GN=FAU PE=1 SV=1 38 113 2.0E-07
sp|Q19KS6|UBL4B_MONDO Ubiquitin-like protein 4B OS=Monodelphis domestica GN=UBL4B PE=2 SV=1 38 109 2.0E-07
sp|Q6PA26|BAG6B_XENLA Large proline-rich protein bag6-B OS=Xenopus laevis GN=Bag6-b PE=2 SV=1 37 109 3.0E-07
sp|A7E320|UHRF1_BOVIN E3 ubiquitin-protein ligase UHRF1 OS=Bos taurus GN=UHRF1 PE=2 SV=1 38 124 3.0E-07
sp|A4IH17|BAG6_XENTR Large proline-rich protein bag6 OS=Xenopus tropicalis GN=Bag6 PE=2 SV=1 38 109 4.0E-07
sp|A7X5R6|BAG6_ORNAN Large proline-rich protein BAG6 OS=Ornithorhynchus anatinus GN=BAG6 PE=3 SV=1 38 109 4.0E-07
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 38 109 5.0E-07
sp|Q84L30|RD23D_ARATH Ubiquitin receptor RAD23d OS=Arabidopsis thaliana GN=RAD23D PE=1 SV=2 38 108 7.0E-07
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 38 109 8.0E-07
sp|Q9ZPY9|P4KG4_ARATH Phosphatidylinositol 4-kinase gamma 4 OS=Arabidopsis thaliana GN=PI4KG4 PE=1 SV=1 44 110 9.0E-07
sp|Q15459|SF3A1_HUMAN Splicing factor 3A subunit 1 OS=Homo sapiens GN=SF3A1 PE=1 SV=1 45 116 1.0E-06
sp|A2VDN6|SF3A1_BOVIN Splicing factor 3A subunit 1 OS=Bos taurus GN=SF3A1 PE=2 SV=1 45 116 1.0E-06
sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 38 109 1.0E-06
sp|O15205|UBD_HUMAN Ubiquitin D OS=Homo sapiens GN=UBD PE=1 SV=2 52 113 1.0E-06
sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=1 SV=2 38 109 1.0E-06
sp|Q64339|ISG15_MOUSE Ubiquitin-like protein ISG15 OS=Mus musculus GN=Isg15 PE=1 SV=4 34 114 2.0E-06
sp|Q2T9Q2|UBL4B_BOVIN Ubiquitin-like protein 4B OS=Bos taurus GN=UBL4B PE=2 SV=1 38 109 2.0E-06
sp|Q40742|RAD23_ORYSJ Probable ubiquitin receptor RAD23 OS=Oryza sativa subsp. japonica GN=RAD23 PE=1 SV=2 38 127 2.0E-06
sp|Q8K4Z5|SF3A1_MOUSE Splicing factor 3A subunit 1 OS=Mus musculus GN=Sf3a1 PE=1 SV=1 45 116 2.0E-06
sp|Q91WB7|UBTD1_MOUSE Ubiquitin domain-containing protein 1 OS=Mus musculus GN=Ubtd1 PE=2 SV=1 34 108 2.0E-06
sp|Q68FV8|UBTD1_RAT Ubiquitin domain-containing protein 1 OS=Rattus norvegicus GN=Ubtd1 PE=2 SV=1 34 108 3.0E-06
sp|Q921A3|UBD_RAT Ubiquitin D OS=Rattus norvegicus GN=Ubd PE=1 SV=1 47 113 3.0E-06
sp|Q9NIF3|UBQL_DICDI Ubiquilin OS=Dictyostelium discoideum GN=ubqln PE=1 SV=1 40 121 3.0E-06
sp|A3KPW9|BAG6_DANRE Large proline-rich protein BAG6 OS=Danio rerio GN=Bag6 PE=3 SV=1 36 109 4.0E-06
sp|Q3ZBQ1|UBTD1_BOVIN Ubiquitin domain-containing protein 1 OS=Bos taurus GN=UBTD1 PE=2 SV=1 34 108 4.0E-06
sp|Q9HAC8|UBTD1_HUMAN Ubiquitin domain-containing protein 1 OS=Homo sapiens GN=UBTD1 PE=1 SV=1 34 108 4.0E-06
sp|Q8N7F7|UBL4B_HUMAN Ubiquitin-like protein 4B OS=Homo sapiens GN=UBL4B PE=1 SV=1 38 157 4.0E-06
sp|Q4V8W7|UBTD1_DANRE Ubiquitin domain-containing protein 1 OS=Danio rerio GN=ubtd1 PE=2 SV=1 37 108 6.0E-06
sp|Q9CQ84|UBL4B_MOUSE Ubiquitin-like protein 4B OS=Mus musculus GN=Ubl4b PE=2 SV=1 38 164 7.0E-06
sp|Q54L35|NED82_DICDI NEDD8-like protein 2 OS=Dictyostelium discoideum GN=nedd8l2 PE=3 SV=1 46 108 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0005515 protein binding Yes
GO:0019538 protein metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043229 intracellular organelle No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0005488 binding No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043226 organelle No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0008150 biological_process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009987 cellular process No
GO:0043043 peptide biosynthetic process No
GO:0005198 structural molecule activity No
GO:0006807 nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0043604 amide biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5457 0.7213 0.1707 0.2522 0.124 0.0091 0.2645 0.1362 0.0576 0.0025

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2699
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3716
Ophiocordyceps australis map64 (Brazil) OphauB2|6694
Ophiocordyceps camponoti-floridani Ophcf2|02147
Ophiocordyceps camponoti-rufipedis Ophun1|6892
Ophiocordyceps kimflemingae Ophio5|3941
Ophiocordyceps subramaniannii Hirsu2|4210 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4210
MGNPRSCDPPSSEPAEAPPQISLQTATPPELVYCRGKMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPP
DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVDKDGN
IERLRRECPSDTCGAGVFMASMPDRQYCGRCHLTYVFDKQ*
Coding >Hirsu2|4210
ATGGGAAACCCTAGGTCATGTGACCCACCCTCGTCTGAGCCCGCCGAGGCCCCTCCCCAAATTTCGCTGCAAACC
GCCACTCCACCCGAGCTGGTCTATTGTCGAGGCAAGATGCAGATCTTCGTCAAGACCCTCACGGGGAAGACGATC
ACCCTTGAGGTGGAGTCTTCCGACACCATCGACAACGTCAAGTCCAAGATCCAGGACAAGGAGGGCATCCCGCCG
GACCAGCAGCGCCTGATCTTCGCCGGCAAGCAGCTCGAGGATGGCCGCACCCTGAGCGACTACAACATCCAGAAG
GAGAGCACCCTGCACCTGGTGCTGCGCCTGCGCGGTGGTGCCAAGAAGCGCAAGAAGAAGGTCTACACCACGCCC
AAGAAGATCAAGCACAAGCGCAAGAAGACCAAGCTGGCCGTGCTCAAGTACTACAAGGTCGACAAGGACGGCAAC
ATCGAGCGTCTGCGACGCGAGTGCCCCAGCGACACCTGCGGTGCCGGTGTCTTCATGGCCTCCATGCCCGACCGC
CAGTACTGTGGCCGTTGCCACCTGACCTACGTCTTTGACAAGCAATAA
Transcript >Hirsu2|4210
ATGGGAAACCCTAGGTCATGTGACCCACCCTCGTCTGAGCCCGCCGAGGCCCCTCCCCAAATTTCGCTGCAAACC
GCCACTCCACCCGAGCTGGTCTATTGTCGAGGCAAGATGCAGATCTTCGTCAAGACCCTCACGGGGAAGACGATC
ACCCTTGAGGTGGAGTCTTCCGACACCATCGACAACGTCAAGTCCAAGATCCAGGACAAGGAGGGCATCCCGCCG
GACCAGCAGCGCCTGATCTTCGCCGGCAAGCAGCTCGAGGATGGCCGCACCCTGAGCGACTACAACATCCAGAAG
GAGAGCACCCTGCACCTGGTGCTGCGCCTGCGCGGTGGTGCCAAGAAGCGCAAGAAGAAGGTCTACACCACGCCC
AAGAAGATCAAGCACAAGCGCAAGAAGACCAAGCTGGCCGTGCTCAAGTACTACAAGGTCGACAAGGACGGCAAC
ATCGAGCGTCTGCGACGCGAGTGCCCCAGCGACACCTGCGGTGCCGGTGTCTTCATGGCCTCCATGCCCGACCGC
CAGTACTGTGGCCGTTGCCACCTGACCTACGTCTTTGACAAGCAATAA
Gene >Hirsu2|4210
ATGGGAAACCCTAGGTCATGTGACCCACCCTCGTCTGAGCCCGCCGAGGCCCCTCCCCAAATTTCGCTGCAAACC
GCCACTCCACCCGAGCTGGTCCTTTTTTCCCCTTCAACCGCAACATCTGAGGATTGCTTAGGACGGCAATAGGTC
TATTGTCGAGGTATGTCTGAAAGATGTCGCGTTTCTCTGCCTTGCCCCCTTGAGACCCTCTCTTCGGCCTCCGCG
TCACCTCCCATTTTCTTGCCCGGGATTTTCTCGAGGCCGACGCCTCCTGCCGTCGCTGCATTGTGTCGCAGGATG
GCCGGCTCGGCGAGAACTCCCGGACGGCGGCGATGTTGTGTCTAACTCTGGCGGCCAGGCAAGATGCAGATCTTC
GTCAAGACCCTCACGGGGAAGACGATCACCCTTGAGGTGGAGTCTTCCGACACCATCGACAACGTCAAGTCCAAG
ATCCAGGACAAGGAGGGCATCCCGCCGGACCAGCAGCGCCTGATCTTCGCCGGCAAGCAGCTCGAGGATGGCCGC
ACCCTGAGCGACTACAACATCCAGAAGGAGAGCACCCTGCACCTGGTGCTGCGCCTGCGCGGTGGTGCCAAGAAG
CGCAAGAAGAAGGTCTACACCACGCCCAAGAAGATCAAGCACAAGCGCAAGAAGACCAAGCTGGCCGTGCTCAAG
TACTACAAGGTCGACAAGGACGGCAACATCGAGCGTCTGCGACGCGAGTGCCCCAGCGACACCGTAAGCCGCCCC
CCTCTCCCGCCGCCCCCTGCGGTCAGGGTCTATCAACCGGAGATGCTAACGCGATGTCACTCGCAGTGCGGTGCC
GGTGTCTTCATGGCCTCCATGCCCGACCGCCAGTACTGTGGCCGTTGCCACCTGACCTACGTCTTTGACAAGCAA
TAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail