Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|421
Gene name
LocationContig_1084:2674..4980
Strand+
Gene length (bp)2306
Transcript length (bp)2118
Coding sequence length (bp)2118
Protein length (aa) 706

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 2.0E-03 562 585
PF00096 zf-C2H2 Zinc finger, C2H2 type 3.0E-04 592 613
PF00096 zf-C2H2 Zinc finger, C2H2 type 4.3E-03 619 642
PF13912 zf-C2H2_6 C2H2-type zinc finger 2.0E-04 619 644

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47043|ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZAP1 PE=1 SV=1 420 635 6.0E-34
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 514 648 2.0E-29
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 468 646 5.0E-29
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 470 673 6.0E-29
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 436 650 9.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47043|ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZAP1 PE=1 SV=1 420 635 6.0E-34
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 514 648 2.0E-29
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 468 646 5.0E-29
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 470 673 6.0E-29
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 436 650 9.0E-29
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 468 671 1.0E-28
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 468 671 1.0E-28
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 468 644 2.0E-28
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 514 648 2.0E-28
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 514 648 2.0E-28
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 468 671 2.0E-28
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 468 687 4.0E-28
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 472 646 4.0E-28
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 468 648 7.0E-28
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 471 646 8.0E-28
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 468 651 1.0E-27
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 472 650 1.0E-27
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 514 645 1.0E-27
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 468 648 1.0E-27
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 468 650 2.0E-27
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 513 646 2.0E-27
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 513 646 2.0E-27
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 472 650 2.0E-27
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 472 671 2.0E-27
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 514 649 2.0E-27
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 468 648 2.0E-27
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 514 649 2.0E-27
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 466 639 3.0E-27
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 472 650 3.0E-27
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 468 654 4.0E-27
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 513 646 4.0E-27
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 513 646 4.0E-27
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 416 637 4.0E-27
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 470 648 4.0E-27
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 468 637 4.0E-27
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 468 644 4.0E-27
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 472 688 4.0E-27
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 472 648 5.0E-27
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 472 648 5.0E-27
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 470 685 5.0E-27
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 468 648 6.0E-27
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 514 671 7.0E-27
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 472 646 7.0E-27
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 514 671 7.0E-27
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 468 650 7.0E-27
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 514 646 7.0E-27
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 468 638 7.0E-27
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 463 673 8.0E-27
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 468 648 8.0E-27
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 472 646 8.0E-27
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 472 646 8.0E-27
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 472 646 9.0E-27
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 514 673 9.0E-27
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 468 648 9.0E-27
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 514 650 1.0E-26
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 514 648 1.0E-26
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 514 673 1.0E-26
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 514 673 1.0E-26
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 472 646 1.0E-26
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 468 648 1.0E-26
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 473 651 1.0E-26
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 472 641 1.0E-26
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 472 671 1.0E-26
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 514 671 1.0E-26
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 473 651 1.0E-26
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 468 643 1.0E-26
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 468 648 1.0E-26
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 470 648 1.0E-26
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 648 1.0E-26
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 423 649 1.0E-26
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 468 671 1.0E-26
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 472 671 1.0E-26
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 514 671 2.0E-26
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 472 671 2.0E-26
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 472 650 2.0E-26
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 470 671 2.0E-26
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 468 665 2.0E-26
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 514 685 2.0E-26
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 470 650 2.0E-26
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 468 671 2.0E-26
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 468 685 2.0E-26
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 472 646 3.0E-26
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 514 671 3.0E-26
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 514 648 3.0E-26
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 470 646 3.0E-26
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 514 668 3.0E-26
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 514 671 3.0E-26
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 511 671 3.0E-26
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 384 648 3.0E-26
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 514 671 3.0E-26
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 514 671 4.0E-26
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 468 671 4.0E-26
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 472 671 4.0E-26
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 472 637 4.0E-26
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 514 638 4.0E-26
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 468 648 4.0E-26
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 514 641 4.0E-26
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 468 643 4.0E-26
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 514 658 4.0E-26
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 468 687 4.0E-26
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 472 646 4.0E-26
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 466 637 4.0E-26
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 514 673 5.0E-26
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 514 650 5.0E-26
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 468 648 5.0E-26
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 470 648 5.0E-26
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 514 648 6.0E-26
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 468 671 7.0E-26
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 468 673 7.0E-26
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 420 648 7.0E-26
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 468 650 7.0E-26
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 514 645 7.0E-26
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 468 665 7.0E-26
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 468 688 7.0E-26
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 514 671 8.0E-26
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 445 650 8.0E-26
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 445 650 8.0E-26
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 468 648 8.0E-26
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 468 641 9.0E-26
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 472 648 9.0E-26
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 514 646 9.0E-26
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 514 637 9.0E-26
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 468 652 9.0E-26
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 514 638 9.0E-26
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 468 650 9.0E-26
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 468 654 9.0E-26
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 472 630 1.0E-25
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 465 646 1.0E-25
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 491 648 1.0E-25
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 472 671 1.0E-25
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 514 671 1.0E-25
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 468 671 1.0E-25
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 468 671 1.0E-25
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 468 646 1.0E-25
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 468 646 1.0E-25
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 468 650 1.0E-25
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 514 651 1.0E-25
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 514 651 1.0E-25
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 468 651 1.0E-25
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 472 637 1.0E-25
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 445 650 1.0E-25
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 514 646 1.0E-25
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 472 656 1.0E-25
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 468 648 1.0E-25
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 472 652 1.0E-25
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 472 671 1.0E-25
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 472 671 1.0E-25
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 514 646 1.0E-25
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 468 648 1.0E-25
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 514 660 2.0E-25
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 470 640 2.0E-25
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 425 646 2.0E-25
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 468 681 2.0E-25
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 468 646 2.0E-25
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 472 671 2.0E-25
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 468 671 2.0E-25
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 472 671 2.0E-25
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 514 648 2.0E-25
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 468 671 2.0E-25
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 468 671 2.0E-25
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 514 671 2.0E-25
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 468 673 2.0E-25
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 491 650 2.0E-25
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 514 650 2.0E-25
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 514 646 2.0E-25
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 514 646 2.0E-25
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 472 648 2.0E-25
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 468 634 2.0E-25
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 514 646 2.0E-25
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 468 648 2.0E-25
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 514 648 2.0E-25
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 468 648 2.0E-25
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 472 650 2.0E-25
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 468 646 2.0E-25
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 472 648 2.0E-25
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 511 637 2.0E-25
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 514 648 3.0E-25
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 472 650 3.0E-25
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 468 651 3.0E-25
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 468 643 3.0E-25
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 514 671 3.0E-25
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 468 695 3.0E-25
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 514 673 3.0E-25
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 468 646 3.0E-25
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 471 641 3.0E-25
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 514 648 3.0E-25
sp|Q05516|ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens GN=ZBTB16 PE=1 SV=2 471 649 3.0E-25
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 514 671 3.0E-25
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 468 648 3.0E-25
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 468 650 3.0E-25
sp|Q8TAF7|ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens GN=ZNF461 PE=2 SV=2 468 648 3.0E-25
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 501 646 3.0E-25
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 514 648 3.0E-25
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 514 649 3.0E-25
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 417 646 3.0E-25
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 468 646 3.0E-25
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 468 651 4.0E-25
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 470 650 4.0E-25
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 470 650 4.0E-25
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 513 671 4.0E-25
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 520 637 4.0E-25
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 506 650 4.0E-25
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 468 646 4.0E-25
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 514 650 4.0E-25
sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens GN=GLIS3 PE=2 SV=5 461 616 4.0E-25
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 468 637 4.0E-25
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 470 648 4.0E-25
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 472 687 4.0E-25
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 439 648 5.0E-25
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 468 646 5.0E-25
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 514 646 5.0E-25
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 472 642 5.0E-25
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 456 637 5.0E-25
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 354 648 5.0E-25
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 472 650 5.0E-25
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 354 648 5.0E-25
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 472 671 5.0E-25
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 472 628 5.0E-25
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 395 650 5.0E-25
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 472 671 5.0E-25
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 472 644 5.0E-25
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 470 648 5.0E-25
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 468 646 5.0E-25
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 472 650 5.0E-25
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 327 640 6.0E-25
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 470 650 6.0E-25
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 468 651 6.0E-25
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 520 637 6.0E-25
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 468 648 6.0E-25
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 468 648 6.0E-25
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 470 651 6.0E-25
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 468 648 6.0E-25
sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus GN=Glis1 PE=2 SV=2 461 616 6.0E-25
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 472 644 6.0E-25
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 514 637 6.0E-25
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 405 646 6.0E-25
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 470 687 6.0E-25
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 514 646 6.0E-25
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 468 648 7.0E-25
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 471 651 7.0E-25
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 472 650 7.0E-25
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 468 646 7.0E-25
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 468 650 7.0E-25
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 513 671 7.0E-25
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 468 648 7.0E-25
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 470 637 7.0E-25
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 472 648 7.0E-25
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 472 646 7.0E-25
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 470 644 7.0E-25
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 468 648 7.0E-25
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 514 637 7.0E-25
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 514 671 7.0E-25
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 472 671 7.0E-25
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 472 646 7.0E-25
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 484 671 7.0E-25
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 468 646 7.0E-25
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 470 650 7.0E-25
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 468 648 8.0E-25
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 514 671 8.0E-25
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 472 671 8.0E-25
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 472 646 8.0E-25
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 514 671 8.0E-25
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 468 671 8.0E-25
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 468 671 8.0E-25
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 468 650 8.0E-25
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 472 650 8.0E-25
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 514 646 8.0E-25
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 472 646 8.0E-25
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 452 648 9.0E-25
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 468 671 9.0E-25
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 511 645 9.0E-25
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 472 651 9.0E-25
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 470 644 9.0E-25
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 472 637 9.0E-25
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 472 644 9.0E-25
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 428 646 9.0E-25
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 468 648 9.0E-25
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 468 649 1.0E-24
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 470 637 1.0E-24
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 468 646 1.0E-24
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 472 648 1.0E-24
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 514 650 1.0E-24
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 472 637 1.0E-24
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 472 637 1.0E-24
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 514 646 1.0E-24
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 456 637 1.0E-24
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 472 653 1.0E-24
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 514 650 1.0E-24
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 514 648 1.0E-24
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 484 671 1.0E-24
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 514 671 1.0E-24
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 468 646 1.0E-24
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 514 650 1.0E-24
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 514 671 1.0E-24
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 462 650 1.0E-24
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 454 648 1.0E-24
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 468 650 1.0E-24
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 514 648 1.0E-24
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 472 644 1.0E-24
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 468 650 1.0E-24
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 472 650 1.0E-24
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 468 648 1.0E-24
sp|Q8NBF1|GLIS1_HUMAN Zinc finger protein GLIS1 OS=Homo sapiens GN=GLIS1 PE=2 SV=2 461 616 1.0E-24
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 472 648 1.0E-24
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 501 650 1.0E-24
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 468 651 1.0E-24
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 468 637 1.0E-24
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 514 650 1.0E-24
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 456 664 1.0E-24
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 514 646 1.0E-24
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 514 628 1.0E-24
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 514 650 1.0E-24
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 468 637 1.0E-24
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 472 651 1.0E-24
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 472 671 1.0E-24
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 363 644 1.0E-24
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 472 650 1.0E-24
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 514 648 1.0E-24
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 472 646 1.0E-24
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 472 637 1.0E-24
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 472 652 2.0E-24
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 468 648 2.0E-24
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 472 652 2.0E-24
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 472 652 2.0E-24
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 470 665 2.0E-24
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 470 665 2.0E-24
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 514 671 2.0E-24
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 514 646 2.0E-24
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 488 671 2.0E-24
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 468 640 2.0E-24
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 514 648 2.0E-24
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 470 650 2.0E-24
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 511 648 2.0E-24
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 468 656 2.0E-24
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 468 650 2.0E-24
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 468 639 2.0E-24
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 514 650 2.0E-24
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 470 637 2.0E-24
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 472 648 2.0E-24
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 472 646 2.0E-24
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 470 671 2.0E-24
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 470 650 2.0E-24
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 470 648 2.0E-24
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 471 637 2.0E-24
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 470 646 2.0E-24
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 514 646 2.0E-24
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 470 671 2.0E-24
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 470 650 2.0E-24
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 514 652 2.0E-24
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 472 648 2.0E-24
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 468 639 2.0E-24
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 470 646 2.0E-24
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 514 671 2.0E-24
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 513 646 2.0E-24
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 472 637 2.0E-24
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 395 650 2.0E-24
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 514 646 2.0E-24
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 514 671 2.0E-24
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 472 650 2.0E-24
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 514 687 2.0E-24
sp|Q6XP49|GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus GN=Glis3 PE=1 SV=2 461 616 2.0E-24
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 514 657 2.0E-24
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 472 650 2.0E-24
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 514 645 2.0E-24
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 472 673 2.0E-24
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 514 637 2.0E-24
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 470 650 2.0E-24
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 514 648 2.0E-24
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 472 650 2.0E-24
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 514 648 2.0E-24
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 468 637 2.0E-24
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 468 662 2.0E-24
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 514 646 2.0E-24
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 514 648 2.0E-24
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 514 646 2.0E-24
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 459 648 2.0E-24
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 468 648 3.0E-24
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 472 648 3.0E-24
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 472 681 3.0E-24
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 472 671 3.0E-24
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 514 671 3.0E-24
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 514 648 3.0E-24
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 468 648 3.0E-24
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 470 650 3.0E-24
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 472 652 3.0E-24
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 470 648 3.0E-24
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 514 648 3.0E-24
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 514 650 3.0E-24
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 468 671 3.0E-24
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 418 650 3.0E-24
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 514 648 3.0E-24
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 472 628 3.0E-24
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 514 671 3.0E-24
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 472 649 3.0E-24
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 468 648 3.0E-24
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 514 648 3.0E-24
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 514 671 3.0E-24
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 470 648 3.0E-24
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 472 645 3.0E-24
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 514 651 3.0E-24
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 472 671 3.0E-24
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 468 646 3.0E-24
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 514 671 3.0E-24
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 514 650 3.0E-24
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 514 643 3.0E-24
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 468 671 3.0E-24
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 395 637 3.0E-24
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 468 640 3.0E-24
sp|O60765|Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens GN=ZNF354A PE=2 SV=2 472 671 3.0E-24
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 468 662 3.0E-24
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 468 662 3.0E-24
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 514 650 3.0E-24
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 472 671 3.0E-24
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 504 671 3.0E-24
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 472 650 3.0E-24
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 468 628 3.0E-24
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 468 662 3.0E-24
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 468 671 4.0E-24
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 468 641 4.0E-24
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 514 648 4.0E-24
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 514 687 4.0E-24
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 471 646 4.0E-24
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 511 637 4.0E-24
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 468 648 4.0E-24
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 514 648 4.0E-24
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 468 640 4.0E-24
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 514 650 4.0E-24
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 490 685 4.0E-24
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 468 646 4.0E-24
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 470 648 4.0E-24
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 468 646 4.0E-24
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 472 650 4.0E-24
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 468 685 4.0E-24
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 468 637 4.0E-24
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 514 646 4.0E-24
sp|P51507|ZNF80_PONPY Zinc finger protein 80 OS=Pongo pygmaeus GN=ZNF80 PE=3 SV=1 514 648 4.0E-24
sp|Q8TF68|ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens GN=ZNF384 PE=1 SV=2 470 638 4.0E-24
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 472 648 4.0E-24
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 514 648 4.0E-24
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 514 671 4.0E-24
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 514 646 4.0E-24
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 472 646 4.0E-24
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 472 671 4.0E-24
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 472 648 4.0E-24
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 514 673 5.0E-24
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 484 671 5.0E-24
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 514 650 5.0E-24
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 441 646 5.0E-24
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 468 671 5.0E-24
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 468 650 5.0E-24
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 468 648 5.0E-24
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 470 644 5.0E-24
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 472 673 5.0E-24
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 514 648 5.0E-24
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 451 648 5.0E-24
sp|Q9EQJ4|ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus GN=Znf384 PE=1 SV=1 470 638 5.0E-24
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 454 673 5.0E-24
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 514 671 5.0E-24
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 514 637 5.0E-24
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 468 662 5.0E-24
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 472 650 5.0E-24
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 468 646 5.0E-24
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 472 637 6.0E-24
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 468 638 6.0E-24
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 468 648 6.0E-24
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 514 637 6.0E-24
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 468 648 6.0E-24
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 514 671 6.0E-24
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 472 650 6.0E-24
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 468 687 6.0E-24
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 514 650 6.0E-24
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 470 645 6.0E-24
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 513 648 6.0E-24
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 468 644 6.0E-24
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 468 662 6.0E-24
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 472 671 6.0E-24
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 514 651 6.0E-24
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 472 671 6.0E-24
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 472 650 6.0E-24
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 514 637 7.0E-24
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 637 7.0E-24
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 472 628 7.0E-24
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 514 648 7.0E-24
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 468 648 7.0E-24
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 514 648 7.0E-24
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 514 648 7.0E-24
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 514 650 7.0E-24
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 514 671 7.0E-24
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 468 654 7.0E-24
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 501 671 7.0E-24
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 447 646 7.0E-24
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 472 651 7.0E-24
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 386 646 7.0E-24
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 514 650 7.0E-24
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 472 640 7.0E-24
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 472 648 7.0E-24
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 514 637 7.0E-24
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 514 648 7.0E-24
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 472 646 7.0E-24
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 514 639 7.0E-24
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 472 645 7.0E-24
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 472 637 7.0E-24
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 472 637 7.0E-24
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 472 637 7.0E-24
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 472 637 7.0E-24
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 468 637 8.0E-24
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 468 637 8.0E-24
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 472 650 8.0E-24
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 472 650 8.0E-24
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 514 648 8.0E-24
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 471 637 8.0E-24
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 472 637 8.0E-24
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 514 648 8.0E-24
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 472 646 8.0E-24
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 472 648 9.0E-24
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 468 646 9.0E-24
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 514 648 9.0E-24
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 468 646 9.0E-24
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 514 648 9.0E-24
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 472 646 9.0E-24
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 451 648 9.0E-24
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 508 671 9.0E-24
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 487 637 9.0E-24
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 514 648 9.0E-24
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 514 673 1.0E-23
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 514 660 1.0E-23
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 468 685 1.0E-23
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 468 648 1.0E-23
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 514 648 1.0E-23
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 471 677 1.0E-23
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 468 671 1.0E-23
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 477 671 1.0E-23
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 472 648 1.0E-23
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 468 682 1.0E-23
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 395 637 1.0E-23
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 514 650 1.0E-23
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 468 651 1.0E-23
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 514 652 1.0E-23
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 470 646 1.0E-23
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 514 653 1.0E-23
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 514 646 1.0E-23
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 468 645 1.0E-23
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 514 648 1.0E-23
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 426 628 1.0E-23
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 472 671 1.0E-23
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 470 637 1.0E-23
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 395 637 1.0E-23
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 514 650 1.0E-23
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 472 648 1.0E-23
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 514 650 1.0E-23
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 472 646 1.0E-23
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 514 646 1.0E-23
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 408 648 1.0E-23
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 383 650 1.0E-23
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 514 641 1.0E-23
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 514 637 1.0E-23
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 472 671 1.0E-23
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 447 677 1.0E-23
sp|Q8IVP9|ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens GN=ZNF547 PE=2 SV=2 472 671 1.0E-23
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 465 665 1.0E-23
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 468 663 1.0E-23
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 472 646 2.0E-23
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 468 637 2.0E-23
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 527 650 2.0E-23
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 508 648 2.0E-23
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 472 637 2.0E-23
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 472 671 2.0E-23
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 460 648 2.0E-23
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 472 648 2.0E-23
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 468 637 2.0E-23
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 514 648 2.0E-23
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 442 650 2.0E-23
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 501 673 2.0E-23
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 440 638 2.0E-23
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 501 673 2.0E-23
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 472 650 2.0E-23
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 468 682 2.0E-23
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 468 671 2.0E-23
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 472 648 2.0E-23
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 514 650 2.0E-23
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 501 648 2.0E-23
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 468 671 2.0E-23
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 472 685 2.0E-23
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 502 671 2.0E-23
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 472 646 2.0E-23
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 514 671 2.0E-23
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 472 650 2.0E-23
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 514 687 2.0E-23
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 650 2.0E-23
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 514 650 2.0E-23
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 514 651 2.0E-23
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 514 673 2.0E-23
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 501 671 2.0E-23
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 514 648 2.0E-23
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 514 646 2.0E-23
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 468 646 2.0E-23
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 472 640 2.0E-23
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 472 648 2.0E-23
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 446 648 2.0E-23
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 472 637 2.0E-23
sp|Q9VI93|RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster GN=rn PE=1 SV=2 471 638 2.0E-23
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 501 671 2.0E-23
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 468 641 2.0E-23
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 472 641 2.0E-23
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 468 648 2.0E-23
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 426 650 2.0E-23
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 514 646 2.0E-23
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 468 671 2.0E-23
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 471 642 2.0E-23
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 472 650 2.0E-23
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 513 650 2.0E-23
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 471 647 2.0E-23
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 472 646 2.0E-23
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 472 650 2.0E-23
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 514 637 2.0E-23
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 472 652 2.0E-23
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 514 648 2.0E-23
sp|Q8N2I2|ZN619_HUMAN Zinc finger protein 619 OS=Homo sapiens GN=ZNF619 PE=2 SV=1 468 648 2.0E-23
sp|Q8N141|ZFP82_HUMAN Zinc finger protein 82 homolog OS=Homo sapiens GN=ZFP82 PE=2 SV=1 472 646 2.0E-23
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 514 648 2.0E-23
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 504 646 2.0E-23
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 470 637 3.0E-23
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 451 637 3.0E-23
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 470 646 3.0E-23
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 514 648 3.0E-23
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 468 639 3.0E-23
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 472 639 3.0E-23
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 472 637 3.0E-23
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 468 648 3.0E-23
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 468 651 3.0E-23
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 514 671 3.0E-23
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 470 648 3.0E-23
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 492 645 3.0E-23
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 514 690 3.0E-23
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 472 650 3.0E-23
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 518 677 3.0E-23
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 470 646 3.0E-23
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 468 689 3.0E-23
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 472 650 3.0E-23
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 468 646 3.0E-23
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 472 650 3.0E-23
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 472 671 3.0E-23
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 514 650 3.0E-23
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 472 650 3.0E-23
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 472 649 3.0E-23
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 514 646 3.0E-23
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 514 648 3.0E-23
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 514 650 3.0E-23
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 373 646 3.0E-23
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 468 650 3.0E-23
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 471 642 3.0E-23
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 501 646 3.0E-23
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 468 646 3.0E-23
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 472 677 3.0E-23
sp|Q8TA94|ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens GN=ZNF563 PE=2 SV=1 468 646 3.0E-23
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 468 648 3.0E-23
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 468 645 3.0E-23
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 472 641 3.0E-23
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 468 683 3.0E-23
sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens GN=ZNF20 PE=1 SV=2 468 648 3.0E-23
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 471 642 3.0E-23
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 501 646 3.0E-23
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 468 638 3.0E-23
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 514 646 3.0E-23
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 514 648 3.0E-23
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 514 637 3.0E-23
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 514 648 3.0E-23
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 514 646 3.0E-23
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 514 646 3.0E-23
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 468 646 3.0E-23
sp|Q96NJ3|ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens GN=ZNF285 PE=2 SV=2 472 651 3.0E-23
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 472 665 3.0E-23
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 514 647 3.0E-23
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 470 645 3.0E-23
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 468 648 3.0E-23
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 468 651 4.0E-23
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 472 650 4.0E-23
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 505 650 4.0E-23
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 468 648 4.0E-23
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 468 650 4.0E-23
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 472 637 4.0E-23
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 472 650 4.0E-23
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 514 642 4.0E-23
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 468 671 4.0E-23
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 451 690 4.0E-23
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 514 637 4.0E-23
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 468 650 4.0E-23
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 514 648 4.0E-23
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 514 648 4.0E-23
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 472 650 4.0E-23
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 514 637 4.0E-23
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 514 651 4.0E-23
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 514 628 4.0E-23
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 514 646 4.0E-23
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 504 646 4.0E-23
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 453 671 4.0E-23
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 472 650 4.0E-23
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 472 650 4.0E-23
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 470 650 4.0E-23
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 514 637 4.0E-23
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 472 650 4.0E-23
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 472 650 4.0E-23
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 514 648 4.0E-23
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 472 673 4.0E-23
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 472 650 4.0E-23
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 465 644 4.0E-23
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 468 648 4.0E-23
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 472 648 4.0E-23
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 468 648 4.0E-23
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 468 646 4.0E-23
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 468 648 4.0E-23
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 514 648 4.0E-23
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 468 648 4.0E-23
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 514 648 4.0E-23
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 470 684 4.0E-23
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 514 654 4.0E-23
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 468 648 4.0E-23
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 472 637 5.0E-23
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 470 646 5.0E-23
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 511 648 5.0E-23
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 514 650 5.0E-23
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 527 646 5.0E-23
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 468 637 5.0E-23
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 514 637 5.0E-23
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 514 646 5.0E-23
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 472 650 5.0E-23
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 514 650 5.0E-23
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 472 638 5.0E-23
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 514 646 5.0E-23
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 472 637 5.0E-23
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 514 650 5.0E-23
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 453 671 5.0E-23
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 514 650 5.0E-23
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 514 637 5.0E-23
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 468 651 5.0E-23
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 472 634 5.0E-23
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 496 646 5.0E-23
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 514 648 5.0E-23
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 470 650 5.0E-23
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 472 641 5.0E-23
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 471 646 5.0E-23
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 514 648 5.0E-23
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 472 646 5.0E-23
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 468 650 5.0E-23
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 468 646 5.0E-23
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 472 644 5.0E-23
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 514 637 5.0E-23
sp|Q802Y8|ZB16A_DANRE Zinc finger and BTB domain-containing protein 16-A OS=Danio rerio GN=zbtb16a PE=1 SV=1 471 638 5.0E-23
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 429 646 5.0E-23
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 392 628 5.0E-23
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 468 648 5.0E-23
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 523 650 5.0E-23
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 514 671 5.0E-23
sp|Q6ZNG0|ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens GN=ZNF620 PE=2 SV=1 465 648 5.0E-23
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 470 671 6.0E-23
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 472 637 6.0E-23
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 468 648 6.0E-23
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 395 650 6.0E-23
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 468 646 6.0E-23
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 468 650 6.0E-23
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 514 648 6.0E-23
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 472 646 6.0E-23
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 375 646 6.0E-23
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 468 646 6.0E-23
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 487 646 6.0E-23
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 453 671 6.0E-23
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 472 649 6.0E-23
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 644 6.0E-23
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 507 646 6.0E-23
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 514 646 6.0E-23
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 472 644 6.0E-23
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 472 637 6.0E-23
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 514 646 6.0E-23
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 470 641 6.0E-23
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 468 648 6.0E-23
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 514 648 6.0E-23
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 472 650 6.0E-23
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 514 671 7.0E-23
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 468 648 7.0E-23
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 502 648 7.0E-23
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 470 648 7.0E-23
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 514 671 7.0E-23
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 514 646 7.0E-23
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 671 7.0E-23
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 514 646 7.0E-23
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 514 650 7.0E-23
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 471 644 7.0E-23
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 514 637 7.0E-23
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 472 645 7.0E-23
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 514 646 7.0E-23
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 472 673 7.0E-23
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 637 7.0E-23
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 472 671 7.0E-23
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 468 637 8.0E-23
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 514 648 8.0E-23
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 468 648 8.0E-23
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 648 8.0E-23
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 502 637 8.0E-23
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 514 646 8.0E-23
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 441 648 8.0E-23
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 514 650 8.0E-23
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 514 673 8.0E-23
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 472 651 8.0E-23
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 514 637 8.0E-23
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 470 671 8.0E-23
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 514 650 8.0E-23
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 468 673 8.0E-23
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 468 651 8.0E-23
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 520 637 8.0E-23
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 472 641 8.0E-23
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 471 652 8.0E-23
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 514 671 8.0E-23
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 473 648 8.0E-23
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 472 628 8.0E-23
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 514 650 8.0E-23
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 514 648 9.0E-23
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 514 667 9.0E-23
sp|Q8TAF7|ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens GN=ZNF461 PE=2 SV=2 468 648 9.0E-23
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 470 650 9.0E-23
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 468 678 9.0E-23
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 514 645 9.0E-23
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 514 648 9.0E-23
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 468 673 9.0E-23
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 514 650 9.0E-23
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 472 650 9.0E-23
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 501 646 9.0E-23
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 514 671 9.0E-23
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 472 651 9.0E-23
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 470 648 9.0E-23
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 449 629 9.0E-23
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 451 646 9.0E-23
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 468 650 1.0E-22
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 468 648 1.0E-22
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 468 612 1.0E-22
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 514 641 1.0E-22
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 468 648 1.0E-22
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 470 671 1.0E-22
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 470 671 1.0E-22
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 470 671 1.0E-22
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 468 675 1.0E-22
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 468 646 1.0E-22
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 514 671 1.0E-22
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 468 650 1.0E-22
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 514 648 1.0E-22
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 468 637 1.0E-22
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 472 647 1.0E-22
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 455 660 1.0E-22
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 455 660 1.0E-22
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 490 648 1.0E-22
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 514 648 1.0E-22
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 650 1.0E-22
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 514 650 1.0E-22
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 468 648 1.0E-22
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 468 650 1.0E-22
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 514 650 1.0E-22
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 514 648 1.0E-22
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 514 637 1.0E-22
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 468 628 1.0E-22
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 514 652 1.0E-22
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 514 646 1.0E-22
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 514 648 1.0E-22
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 468 678 1.0E-22
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 514 690 1.0E-22
sp|O60765|Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens GN=ZNF354A PE=2 SV=2 514 646 1.0E-22
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 514 628 1.0E-22
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 514 641 1.0E-22
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 472 640 1.0E-22
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 514 646 1.0E-22
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 513 648 1.0E-22
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 465 648 1.0E-22
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 472 646 1.0E-22
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 463 648 1.0E-22
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 472 637 1.0E-22
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 514 671 1.0E-22
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 488 651 1.0E-22
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 650 1.0E-22
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 468 673 1.0E-22
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 472 671 1.0E-22
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 514 637 1.0E-22
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 468 673 1.0E-22
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 468 648 1.0E-22
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 507 650 1.0E-22
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 472 673 1.0E-22
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 472 628 1.0E-22
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 514 650 1.0E-22
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 514 650 1.0E-22
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 514 650 1.0E-22
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 523 650 1.0E-22
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 449 629 1.0E-22
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 395 648 1.0E-22
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 468 671 1.0E-22
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 507 657 1.0E-22
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 470 642 1.0E-22
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 468 671 1.0E-22
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 395 648 1.0E-22
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 471 642 1.0E-22
sp|P51504|ZNF80_HUMAN Zinc finger protein 80 OS=Homo sapiens GN=ZNF80 PE=2 SV=2 514 648 1.0E-22
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 472 648 1.0E-22
sp|Q5RCX4|ZN547_PONAB Zinc finger protein 547 OS=Pongo abelii GN=ZNF547 PE=2 SV=1 444 671 1.0E-22
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 514 644 1.0E-22
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 514 637 1.0E-22
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 646 1.0E-22
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 468 650 1.0E-22
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 514 643 1.0E-22
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 500 645 1.0E-22
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 514 650 1.0E-22
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 514 638 1.0E-22
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 514 648 1.0E-22
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 471 642 1.0E-22
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 468 646 1.0E-22
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 470 642 1.0E-22
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 514 648 1.0E-22
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 471 644 1.0E-22
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 472 648 1.0E-22
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 468 650 1.0E-22
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 501 658 1.0E-22
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 394 637 1.0E-22
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 468 646 2.0E-22
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 514 671 2.0E-22
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 514 651 2.0E-22
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 514 637 2.0E-22
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 514 646 2.0E-22
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 671 2.0E-22
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 472 671 2.0E-22
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 468 671 2.0E-22
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 514 640 2.0E-22
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 468 650 2.0E-22
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 514 671 2.0E-22
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 468 673 2.0E-22
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 514 650 2.0E-22
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 476 650 2.0E-22
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 468 650 2.0E-22
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 472 648 2.0E-22
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 472 651 2.0E-22
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 468 646 2.0E-22
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 421 648 2.0E-22
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 511 646 2.0E-22
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 519 651 2.0E-22
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 490 648 2.0E-22
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 514 619 2.0E-22
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 468 628 2.0E-22
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 476 648 2.0E-22
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 514 650 2.0E-22
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 468 637 2.0E-22
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 472 671 2.0E-22
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 476 648 2.0E-22
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 468 646 2.0E-22
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 472 637 2.0E-22
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 472 650 2.0E-22
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 472 650 2.0E-22
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 472 650 2.0E-22
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 468 646 2.0E-22
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 514 650 2.0E-22
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 468 673 2.0E-22
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 514 620 2.0E-22
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 514 671 2.0E-22
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 514 650 2.0E-22
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 468 648 2.0E-22
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 514 649 2.0E-22
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 468 650 2.0E-22
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 514 637 2.0E-22
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 495 648 2.0E-22
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 468 651 2.0E-22
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 514 671 2.0E-22
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 514 637 2.0E-22
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 470 671 2.0E-22
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 514 650 2.0E-22
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 472 652 2.0E-22
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 514 664 2.0E-22
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 472 650 2.0E-22
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 514 671 2.0E-22
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 468 628 2.0E-22
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 468 646 2.0E-22
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 468 648 2.0E-22
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 514 646 2.0E-22
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 472 650 2.0E-22
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 514 646 2.0E-22
sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens GN=ZNF20 PE=1 SV=2 468 651 2.0E-22
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 520 650 2.0E-22
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 468 628 2.0E-22
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 514 646 2.0E-22
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 468 628 2.0E-22
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 472 671 2.0E-22
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 468 646 2.0E-22
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 514 637 2.0E-22
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 514 671 2.0E-22
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 646 2.0E-22
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 514 646 2.0E-22
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 386 650 2.0E-22
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 514 650 2.0E-22
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 472 671 2.0E-22
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 500 646 2.0E-22
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 445 673 2.0E-22
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 514 650 2.0E-22
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 514 658 2.0E-22
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 442 650 2.0E-22
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 472 640 2.0E-22
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 514 651 2.0E-22
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 514 648 2.0E-22
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 514 671 2.0E-22
sp|Q9Y2G7|ZFP30_HUMAN Zinc finger protein 30 homolog OS=Homo sapiens GN=ZFP30 PE=2 SV=1 468 646 2.0E-22
sp|Q68EA5|ZNF57_HUMAN Zinc finger protein 57 OS=Homo sapiens GN=ZNF57 PE=2 SV=3 339 648 2.0E-22
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 514 651 2.0E-22
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 514 641 2.0E-22
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 468 671 2.0E-22
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 472 646 2.0E-22
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 520 650 2.0E-22
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 446 642 2.0E-22
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 468 648 2.0E-22
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 472 671 2.0E-22
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 472 648 2.0E-22
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 472 646 2.0E-22
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 470 650 2.0E-22
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 470 637 2.0E-22
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 522 650 2.0E-22
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 514 650 2.0E-22
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 514 638 2.0E-22
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 472 654 2.0E-22
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 472 640 2.0E-22
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 472 650 3.0E-22
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 468 645 3.0E-22
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 514 646 3.0E-22
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 470 637 3.0E-22
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 468 637 3.0E-22
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 468 648 3.0E-22
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 468 637 3.0E-22
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 470 648 3.0E-22
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 472 630 3.0E-22
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 514 648 3.0E-22
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 472 650 3.0E-22
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 511 646 3.0E-22
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 472 645 3.0E-22
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 487 637 3.0E-22
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 470 671 3.0E-22
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 514 648 3.0E-22
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 468 677 3.0E-22
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 514 650 3.0E-22
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 468 671 3.0E-22
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 472 637 3.0E-22
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 472 649 3.0E-22
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 468 671 3.0E-22
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 472 650 3.0E-22
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 472 645 3.0E-22
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 514 637 3.0E-22
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 514 668 3.0E-22
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 514 641 3.0E-22
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 472 671 3.0E-22
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 468 648 3.0E-22
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 514 648 3.0E-22
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 472 650 3.0E-22
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 514 646 3.0E-22
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 470 651 3.0E-22
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 514 646 3.0E-22
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 514 646 3.0E-22
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 468 650 3.0E-22
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 468 648 3.0E-22
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 472 671 3.0E-22
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 514 671 3.0E-22
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 468 648 3.0E-22
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 472 650 3.0E-22
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 449 646 3.0E-22
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 471 644 3.0E-22
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 501 671 3.0E-22
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 468 648 3.0E-22
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 468 637 3.0E-22
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 503 648 4.0E-22
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 470 673 4.0E-22
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 468 648 4.0E-22
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 514 640 4.0E-22
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 472 644 4.0E-22
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 514 650 4.0E-22
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 470 648 4.0E-22
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 514 638 4.0E-22
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 468 650 4.0E-22
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 408 651 4.0E-22
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 514 644 4.0E-22
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 514 657 4.0E-22
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 468 650 4.0E-22
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 468 673 4.0E-22
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 472 650 4.0E-22
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 468 646 4.0E-22
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 471 628 4.0E-22
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 637 4.0E-22
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 472 650 4.0E-22
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 468 650 4.0E-22
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 473 651 4.0E-22
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 514 646 4.0E-22
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 514 650 4.0E-22
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 514 637 4.0E-22
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 514 646 4.0E-22
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 429 646 4.0E-22
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 426 637 4.0E-22
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 468 650 4.0E-22
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 514 646 4.0E-22
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 468 646 4.0E-22
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 468 646 5.0E-22
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 468 646 5.0E-22
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 470 637 5.0E-22
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 671 5.0E-22
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 470 677 5.0E-22
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 514 650 5.0E-22
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 470 648 5.0E-22
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 389 650 5.0E-22
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 514 650 5.0E-22
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 503 690 5.0E-22
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 472 645 5.0E-22
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 354 650 5.0E-22
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 468 646 5.0E-22
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 470 671 5.0E-22
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 468 650 5.0E-22
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 514 650 5.0E-22
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 650 5.0E-22
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 468 648 5.0E-22
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 514 671 5.0E-22
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 468 646 5.0E-22
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 508 656 5.0E-22
sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens GN=ZNF20 PE=1 SV=2 467 648 5.0E-22
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 514 650 5.0E-22
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 514 650 5.0E-22
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 514 652 5.0E-22
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 514 646 5.0E-22
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 443 646 5.0E-22
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 514 652 5.0E-22
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 472 637 5.0E-22
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 468 650 5.0E-22
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 472 677 5.0E-22
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 468 650 5.0E-22
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 472 650 6.0E-22
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 514 648 6.0E-22
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 468 641 6.0E-22
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 472 637 6.0E-22
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 472 651 6.0E-22
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 472 650 6.0E-22
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 472 637 6.0E-22
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 514 648 6.0E-22
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 470 671 6.0E-22
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 473 651 6.0E-22
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 514 650 6.0E-22
sp|Q8TA94|ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens GN=ZNF563 PE=2 SV=1 514 648 6.0E-22
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 472 646 6.0E-22
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 514 650 6.0E-22
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 472 650 6.0E-22
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 472 650 7.0E-22
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 468 650 7.0E-22
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 468 646 7.0E-22
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 468 646 7.0E-22
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 498 648 7.0E-22
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 472 646 7.0E-22
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 472 650 7.0E-22
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 472 650 7.0E-22
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 471 645 7.0E-22
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 501 650 7.0E-22
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 531 671 7.0E-22
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 472 646 7.0E-22
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 468 646 7.0E-22
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 472 659 7.0E-22
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 514 650 7.0E-22
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 515 687 8.0E-22
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 468 644 8.0E-22
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 514 648 8.0E-22
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 514 648 8.0E-22
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 514 650 8.0E-22
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 472 646 8.0E-22
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 472 658 8.0E-22
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 468 628 8.0E-22
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 470 648 8.0E-22
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 468 637 8.0E-22
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 472 646 8.0E-22
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 468 650 8.0E-22
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 514 640 8.0E-22
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 468 673 8.0E-22
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 504 648 8.0E-22
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 470 646 8.0E-22
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 514 650 8.0E-22
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 531 646 9.0E-22
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 470 648 9.0E-22
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 472 650 9.0E-22
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 514 650 9.0E-22
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 468 646 9.0E-22
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 512 650 9.0E-22
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 472 646 1.0E-21
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 515 671 1.0E-21
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 468 615 1.0E-21
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 472 664 1.0E-21
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 470 648 1.0E-21
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 468 650 1.0E-21
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 523 650 1.0E-21
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 472 637 1.0E-21
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 472 671 1.0E-21
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 514 650 1.0E-21
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 514 650 1.0E-21
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 472 637 1.0E-21
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 468 648 1.0E-21
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 468 637 1.0E-21
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 468 650 1.0E-21
sp|Q8TAF7|ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens GN=ZNF461 PE=2 SV=2 522 648 1.0E-21
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 514 641 1.0E-21
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 514 650 1.0E-21
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 470 651 1.0E-21
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 468 646 1.0E-21
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 514 650 1.0E-21
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 472 650 1.0E-21
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 514 638 1.0E-21
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 468 648 1.0E-21
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 514 641 1.0E-21
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 514 638 1.0E-21
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 516 650 1.0E-21
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 472 664 1.0E-21
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 514 650 1.0E-21
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 470 671 1.0E-21
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 468 648 1.0E-21
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 470 671 1.0E-21
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 472 659 1.0E-21
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 514 677 1.0E-21
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 472 651 1.0E-21
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 514 650 1.0E-21
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 472 646 1.0E-21
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 514 687 1.0E-21
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 468 648 1.0E-21
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 451 671 1.0E-21
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 514 653 1.0E-21
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 514 656 1.0E-21
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 470 650 1.0E-21
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 468 637 1.0E-21
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 468 648 1.0E-21
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 514 650 1.0E-21
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 514 648 1.0E-21
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 472 650 1.0E-21
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 472 650 1.0E-21
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 472 650 1.0E-21
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 514 648 1.0E-21
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 472 646 2.0E-21
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 472 646 2.0E-21
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 514 648 2.0E-21
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 472 646 2.0E-21
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 490 648 2.0E-21
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 514 650 2.0E-21
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 514 648 2.0E-21
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 501 637 2.0E-21
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 514 637 2.0E-21
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 472 643 2.0E-21
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 514 651 2.0E-21
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 468 637 2.0E-21
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 468 637 2.0E-21
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 468 648 2.0E-21
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 516 646 2.0E-21
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 468 650 2.0E-21
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 514 648 2.0E-21
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 472 671 2.0E-21
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 514 648 2.0E-21
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 472 648 2.0E-21
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 514 649 2.0E-21
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 452 648 2.0E-21
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 514 686 2.0E-21
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 514 671 2.0E-21
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 472 652 2.0E-21
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 468 651 2.0E-21
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 514 671 2.0E-21
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 470 650 2.0E-21
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 472 651 2.0E-21
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 514 673 2.0E-21
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 468 650 2.0E-21
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 468 628 2.0E-21
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 468 637 2.0E-21
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 472 637 2.0E-21
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 470 648 2.0E-21
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 514 648 2.0E-21
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 514 648 2.0E-21
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 511 646 2.0E-21
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 472 648 2.0E-21
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 472 674 2.0E-21
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 472 650 2.0E-21
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 468 637 2.0E-21
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 468 646 2.0E-21
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 514 644 2.0E-21
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 472 650 2.0E-21
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 472 648 2.0E-21
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 472 671 2.0E-21
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 514 646 2.0E-21
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 454 616 2.0E-21
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 470 646 2.0E-21
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 518 650 2.0E-21
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 514 637 2.0E-21
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 514 641 2.0E-21
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 514 642 2.0E-21
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 472 653 2.0E-21
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 468 673 2.0E-21
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 468 648 2.0E-21
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 488 651 2.0E-21
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 514 671 2.0E-21
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 451 651 2.0E-21
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 472 650 2.0E-21
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 514 646 2.0E-21
sp|Q96NJ3|ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens GN=ZNF285 PE=2 SV=2 472 637 2.0E-21
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 468 648 2.0E-21
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 514 648 2.0E-21
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 470 650 2.0E-21
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 473 648 2.0E-21
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 507 646 2.0E-21
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 468 648 2.0E-21
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 468 648 2.0E-21
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 472 646 2.0E-21
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 468 648 2.0E-21
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 472 674 2.0E-21
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 514 646 2.0E-21
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 472 646 2.0E-21
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 468 650 2.0E-21
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 514 671 3.0E-21
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 514 648 3.0E-21
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 468 662 3.0E-21
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 514 671 3.0E-21
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 511 648 3.0E-21
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 514 671 3.0E-21
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 468 675 3.0E-21
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 514 650 3.0E-21
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 516 646 3.0E-21
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 514 673 3.0E-21
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 472 650 3.0E-21
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 468 637 3.0E-21
sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 472 646 3.0E-21
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 514 673 3.0E-21
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 472 650 3.0E-21
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 514 637 3.0E-21
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 514 649 3.0E-21
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 518 646 3.0E-21
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 471 628 3.0E-21
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 443 648 3.0E-21
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 520 684 3.0E-21
sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens GN=ZNF20 PE=1 SV=2 468 648 3.0E-21
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 468 650 3.0E-21
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 468 648 3.0E-21
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 451 646 3.0E-21
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 514 650 3.0E-21
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 472 637 3.0E-21
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 472 646 3.0E-21
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 514 650 3.0E-21
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 514 650 3.0E-21
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 514 648 3.0E-21
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 514 650 3.0E-21
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 514 648 3.0E-21
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 514 671 3.0E-21
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 514 668 3.0E-21
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 394 646 3.0E-21
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 468 646 3.0E-21
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 514 648 4.0E-21
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 468 651 4.0E-21
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 468 638 4.0E-21
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 472 671 4.0E-21
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 523 671 4.0E-21
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 468 671 4.0E-21
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 514 650 4.0E-21
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 470 648 4.0E-21
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 470 637 4.0E-21
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 472 616 4.0E-21
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 514 646 4.0E-21
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 520 650 4.0E-21
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 453 665 4.0E-21
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 468 648 4.0E-21
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 514 642 4.0E-21
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 470 648 4.0E-21
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 514 671 4.0E-21
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 514 655 4.0E-21
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 514 637 4.0E-21
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 468 648 4.0E-21
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 491 650 4.0E-21
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 514 642 4.0E-21
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 406 637 4.0E-21
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 514 648 4.0E-21
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 514 659 4.0E-21
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 472 650 4.0E-21
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 472 646 5.0E-21
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 637 5.0E-21
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 646 5.0E-21
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 522 646 5.0E-21
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 472 650 5.0E-21
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 468 662 5.0E-21
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 510 628 5.0E-21
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 472 613 5.0E-21
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 514 673 5.0E-21
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 514 654 5.0E-21
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 514 671 5.0E-21
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 472 646 5.0E-21
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 472 650 5.0E-21
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 527 650 5.0E-21
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 426 650 5.0E-21
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 472 650 5.0E-21
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 472 650 5.0E-21
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 472 646 5.0E-21
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 470 618 6.0E-21
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 468 673 6.0E-21
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 514 671 6.0E-21
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 472 646 6.0E-21
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 468 654 6.0E-21
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 472 619 6.0E-21
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 470 628 6.0E-21
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 526 673 6.0E-21
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 514 646 6.0E-21
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 514 650 6.0E-21
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 514 648 6.0E-21
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 514 637 6.0E-21
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 470 646 6.0E-21
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 483 648 6.0E-21
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 514 648 6.0E-21
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 468 652 6.0E-21
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 514 637 6.0E-21
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 472 673 7.0E-21
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 472 613 7.0E-21
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 472 671 7.0E-21
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 514 648 7.0E-21
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 514 671 7.0E-21
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 514 671 7.0E-21
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 471 634 7.0E-21
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 393 637 7.0E-21
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 472 619 7.0E-21
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 472 628 7.0E-21
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 472 671 7.0E-21
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 472 619 7.0E-21
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 514 646 7.0E-21
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 472 617 7.0E-21
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 514 648 7.0E-21
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 472 637 7.0E-21
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 514 648 7.0E-21
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 468 646 7.0E-21
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 514 648 7.0E-21
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 504 637 7.0E-21
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 468 646 7.0E-21
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 514 637 7.0E-21
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 507 671 7.0E-21
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 472 648 7.0E-21
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 515 646 7.0E-21
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 468 652 7.0E-21
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 472 650 7.0E-21
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 472 637 7.0E-21
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 472 646 8.0E-21
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 472 641 8.0E-21
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 507 684 8.0E-21
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 472 646 8.0E-21
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 514 671 8.0E-21
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 476 650 8.0E-21
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 472 617 8.0E-21
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 472 617 8.0E-21
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 472 617 8.0E-21
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 472 671 8.0E-21
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 472 646 8.0E-21
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 514 650 8.0E-21
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 520 671 8.0E-21
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 514 646 8.0E-21
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 514 646 9.0E-21
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 470 648 9.0E-21
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 514 620 9.0E-21
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 508 684 9.0E-21
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 465 681 9.0E-21
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 514 637 9.0E-21
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 470 648 9.0E-21
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 514 671 9.0E-21
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 472 617 9.0E-21
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 514 639 9.0E-21
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 514 668 9.0E-21
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 472 648 9.0E-21
sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 472 654 9.0E-21
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 518 650 9.0E-21
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 514 648 9.0E-21
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 523 646 9.0E-21
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 522 646 1.0E-20
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 518 650 1.0E-20
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 468 650 1.0E-20
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 505 646 1.0E-20
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 514 644 1.0E-20
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 468 646 1.0E-20
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 468 651 1.0E-20
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 472 646 1.0E-20
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 472 648 1.0E-20
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 514 648 1.0E-20
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 472 671 1.0E-20
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 514 648 1.0E-20
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 514 646 1.0E-20
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 470 646 1.0E-20
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 470 646 1.0E-20
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 513 646 1.0E-20
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 514 637 1.0E-20
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 522 646 1.0E-20
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 468 637 1.0E-20
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 468 614 1.0E-20
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 472 645 1.0E-20
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 472 650 1.0E-20
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 468 671 1.0E-20
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 514 638 1.0E-20
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 514 646 1.0E-20
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 468 651 1.0E-20
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 514 650 1.0E-20
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 514 648 1.0E-20
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 472 650 1.0E-20
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 514 645 1.0E-20
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 514 671 1.0E-20
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 468 648 1.0E-20
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 532 646 1.0E-20
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 472 617 1.0E-20
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 532 646 1.0E-20
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 514 646 1.0E-20
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 514 704 1.0E-20
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 514 650 1.0E-20
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 514 646 1.0E-20
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 472 650 1.0E-20
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 514 641 1.0E-20
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 472 637 1.0E-20
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 646 1.0E-20
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 272 628 1.0E-20
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 514 650 1.0E-20
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 514 666 1.0E-20
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 514 646 1.0E-20
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 514 646 1.0E-20
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 520 656 1.0E-20
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 511 646 1.0E-20
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 463 646 1.0E-20
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 472 628 1.0E-20
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 514 638 1.0E-20
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 514 671 2.0E-20
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 514 671 2.0E-20
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 468 641 2.0E-20
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 523 671 2.0E-20
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 339 646 2.0E-20
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 472 671 2.0E-20
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 514 646 2.0E-20
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 510 648 2.0E-20
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 468 670 2.0E-20
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 520 654 2.0E-20
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 468 637 2.0E-20
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 472 639 2.0E-20
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 470 656 2.0E-20
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 468 650 2.0E-20
sp|Q8TAF7|ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens GN=ZNF461 PE=2 SV=2 514 654 2.0E-20
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 514 646 2.0E-20
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 507 684 2.0E-20
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 442 650 2.0E-20
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 514 671 2.0E-20
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 514 646 2.0E-20
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 472 615 2.0E-20
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 514 650 2.0E-20
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 472 650 2.0E-20
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 514 687 2.0E-20
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 468 614 2.0E-20
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 472 651 2.0E-20
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 514 615 2.0E-20
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 468 646 2.0E-20
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 470 673 2.0E-20
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 468 648 2.0E-20
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 514 646 2.0E-20
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 514 646 2.0E-20
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 472 651 2.0E-20
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 468 650 2.0E-20
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 637 2.0E-20
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 646 2.0E-20
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 646 2.0E-20
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 468 646 2.0E-20
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 497 650 2.0E-20
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 472 648 2.0E-20
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 523 648 2.0E-20
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 501 671 2.0E-20
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 503 650 2.0E-20
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 514 646 2.0E-20
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 505 667 2.0E-20
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 503 650 2.0E-20
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 514 639 2.0E-20
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 513 642 2.0E-20
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 503 650 2.0E-20
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 514 639 2.0E-20
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 502 648 2.0E-20
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 514 637 2.0E-20
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 514 671 2.0E-20
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 514 671 3.0E-20
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 472 646 3.0E-20
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 531 646 3.0E-20
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 468 637 3.0E-20
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 514 648 3.0E-20
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 472 677 3.0E-20
sp|Q05516|ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens GN=ZBTB16 PE=1 SV=2 470 646 3.0E-20
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 470 637 3.0E-20
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 468 650 3.0E-20
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 468 651 3.0E-20
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 468 650 3.0E-20
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 472 646 3.0E-20
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 486 637 3.0E-20
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 514 646 3.0E-20
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 514 650 3.0E-20
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 514 650 3.0E-20
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 514 650 3.0E-20
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 514 648 3.0E-20
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 468 671 3.0E-20
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 389 634 3.0E-20
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 468 639 3.0E-20
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 468 682 3.0E-20
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 470 660 3.0E-20
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 472 650 3.0E-20
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 514 671 3.0E-20
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 470 644 3.0E-20
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 468 650 3.0E-20
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 514 639 3.0E-20
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 514 650 3.0E-20
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 502 648 3.0E-20
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 513 646 3.0E-20
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 468 650 3.0E-20
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 470 645 4.0E-20
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 472 646 4.0E-20
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 468 641 4.0E-20
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 514 637 4.0E-20
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 514 613 4.0E-20
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 472 646 4.0E-20
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 514 613 4.0E-20
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 472 673 4.0E-20
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 514 648 4.0E-20
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 468 637 4.0E-20
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 468 648 4.0E-20
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 468 651 4.0E-20
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 468 646 4.0E-20
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 470 628 4.0E-20
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 529 646 4.0E-20
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 472 637 4.0E-20
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 529 646 4.0E-20
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 514 640 4.0E-20
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 514 651 4.0E-20
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 514 650 4.0E-20
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 514 637 4.0E-20
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 514 637 4.0E-20
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 514 637 4.0E-20
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 514 650 4.0E-20
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 511 646 4.0E-20
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 451 671 4.0E-20
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 514 650 4.0E-20
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 468 646 4.0E-20
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 514 651 4.0E-20
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 514 650 4.0E-20
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 472 649 4.0E-20
sp|P51504|ZNF80_HUMAN Zinc finger protein 80 OS=Homo sapiens GN=ZNF80 PE=2 SV=2 514 648 4.0E-20
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 468 652 4.0E-20
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 472 648 4.0E-20
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 514 640 4.0E-20
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 472 650 4.0E-20
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 525 648 5.0E-20
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 468 614 5.0E-20
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 472 649 5.0E-20
sp|Q14585|ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens GN=ZNF345 PE=2 SV=1 522 648 5.0E-20
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 514 637 5.0E-20
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 514 650 5.0E-20
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 472 646 5.0E-20
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 520 650 5.0E-20
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 468 639 5.0E-20
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 468 638 5.0E-20
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 514 637 5.0E-20
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 641 5.0E-20
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 637 5.0E-20
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 646 5.0E-20
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 472 647 5.0E-20
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 472 652 5.0E-20
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 468 646 5.0E-20
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 514 639 5.0E-20
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 514 648 5.0E-20
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 472 646 5.0E-20
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 526 646 5.0E-20
sp|Q9Y2G7|ZFP30_HUMAN Zinc finger protein 30 homolog OS=Homo sapiens GN=ZFP30 PE=2 SV=1 514 648 5.0E-20
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 518 646 5.0E-20
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 525 648 6.0E-20
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 472 671 6.0E-20
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 520 646 6.0E-20
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 514 650 6.0E-20
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 495 650 6.0E-20
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 514 671 6.0E-20
sp|A1YFW2|ZSC12_PANPA Zinc finger and SCAN domain-containing protein 12 OS=Pan paniscus GN=ZSCAN12 PE=3 SV=1 514 650 6.0E-20
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 468 685 6.0E-20
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 472 650 6.0E-20
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 514 646 6.0E-20
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 514 646 6.0E-20
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 514 650 6.0E-20
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 514 650 6.0E-20
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 494 650 6.0E-20
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 472 616 6.0E-20
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 386 671 7.0E-20
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 531 648 7.0E-20
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 514 650 7.0E-20
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 471 636 7.0E-20
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 514 648 7.0E-20
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 522 650 7.0E-20
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 514 650 7.0E-20
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 514 646 7.0E-20
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 514 646 7.0E-20
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 523 674 7.0E-20
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 453 646 7.0E-20
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 514 650 7.0E-20
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 514 645 8.0E-20
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 514 628 8.0E-20
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 514 628 8.0E-20
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 514 646 8.0E-20
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 472 650 8.0E-20
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 531 648 8.0E-20
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 514 646 8.0E-20
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 514 641 8.0E-20
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 472 651 8.0E-20
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 514 646 8.0E-20
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 472 639 8.0E-20
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 514 671 8.0E-20
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 522 651 9.0E-20
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 516 671 9.0E-20
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 518 648 9.0E-20
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 491 671 9.0E-20
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 510 646 9.0E-20
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 514 671 9.0E-20
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 514 641 9.0E-20
sp|Q8N141|ZFP82_HUMAN Zinc finger protein 82 homolog OS=Homo sapiens GN=ZFP82 PE=2 SV=1 514 638 9.0E-20
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 468 648 9.0E-20
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 514 671 9.0E-20
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 514 650 9.0E-20
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 514 650 9.0E-20
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 469 646 9.0E-20
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 464 645 1.0E-19
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 514 671 1.0E-19
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 523 671 1.0E-19
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 468 616 1.0E-19
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 502 650 1.0E-19
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 514 637 1.0E-19
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 514 637 1.0E-19
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 514 637 1.0E-19
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 514 637 1.0E-19
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 468 613 1.0E-19
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 531 646 1.0E-19
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 514 665 1.0E-19
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 522 650 1.0E-19
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 523 650 1.0E-19
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 514 648 1.0E-19
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 531 646 1.0E-19
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 518 650 1.0E-19
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 472 659 1.0E-19
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 470 637 1.0E-19
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 470 637 1.0E-19
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 472 646 1.0E-19
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 514 648 1.0E-19
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 503 646 1.0E-19
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 514 646 1.0E-19
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 472 619 1.0E-19
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 465 671 1.0E-19
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 472 644 1.0E-19
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 514 673 1.0E-19
sp|P51507|ZNF80_PONPY Zinc finger protein 80 OS=Pongo pygmaeus GN=ZNF80 PE=3 SV=1 514 648 1.0E-19
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 514 646 1.0E-19
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 449 650 1.0E-19
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 514 646 1.0E-19
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 472 637 1.0E-19
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 508 650 1.0E-19
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 514 671 1.0E-19
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 514 687 1.0E-19
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 514 646 1.0E-19
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 514 671 1.0E-19
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 394 637 1.0E-19
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 514 650 1.0E-19
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 514 671 1.0E-19
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 514 651 1.0E-19
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 514 671 1.0E-19
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 468 648 1.0E-19
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 514 648 1.0E-19
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 456 641 1.0E-19
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 526 650 1.0E-19
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 514 648 1.0E-19
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 468 650 1.0E-19
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 426 637 1.0E-19
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 518 671 1.0E-19
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 514 671 1.0E-19
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 472 653 1.0E-19
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 514 641 1.0E-19
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 514 648 1.0E-19
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 472 646 1.0E-19
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 472 650 1.0E-19
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 514 651 1.0E-19
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 514 650 1.0E-19
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 514 616 1.0E-19
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 456 641 1.0E-19
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 472 614 2.0E-19
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 525 648 2.0E-19
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 514 671 2.0E-19
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 489 648 2.0E-19
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 468 616 2.0E-19
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 468 628 2.0E-19
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 468 671 2.0E-19
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 468 650 2.0E-19
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 531 648 2.0E-19
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 514 677 2.0E-19
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 514 640 2.0E-19
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 514 648 2.0E-19
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 468 637 2.0E-19
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 514 637 2.0E-19
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 504 671 2.0E-19
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 514 673 2.0E-19
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 514 637 2.0E-19
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 514 650 2.0E-19
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 526 650 2.0E-19
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 470 614 2.0E-19
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 518 648 2.0E-19
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 514 646 2.0E-19
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 514 637 2.0E-19
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 472 650 2.0E-19
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 514 637 2.0E-19
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 522 671 2.0E-19
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 523 677 2.0E-19
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 468 637 2.0E-19
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 472 637 2.0E-19
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 514 648 2.0E-19
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 514 671 2.0E-19
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 514 648 2.0E-19
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 472 670 2.0E-19
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 472 637 2.0E-19
sp|Q6ZNG0|ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens GN=ZNF620 PE=2 SV=1 514 648 2.0E-19
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 472 648 2.0E-19
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 472 653 2.0E-19
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 501 646 2.0E-19
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 500 646 2.0E-19
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 476 648 2.0E-19
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 468 641 2.0E-19
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 527 637 2.0E-19
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 514 637 2.0E-19
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 470 613 2.0E-19
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 468 648 2.0E-19
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 501 648 3.0E-19
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 528 648 3.0E-19
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 514 646 3.0E-19
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 514 671 3.0E-19
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 527 646 3.0E-19
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 468 650 3.0E-19
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 514 648 3.0E-19
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 520 648 3.0E-19
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 514 613 3.0E-19
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 468 650 3.0E-19
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 520 655 3.0E-19
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 468 648 3.0E-19
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 503 648 3.0E-19
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 468 613 3.0E-19
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 514 646 3.0E-19
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 518 638 3.0E-19
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 470 641 3.0E-19
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 514 671 3.0E-19
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 472 674 3.0E-19
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 518 638 3.0E-19
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 468 648 3.0E-19
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 637 3.0E-19
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 468 648 3.0E-19
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 471 650 3.0E-19
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 503 648 3.0E-19
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 615 3.0E-19
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 470 648 3.0E-19
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 349 613 3.0E-19
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 472 650 3.0E-19
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 472 650 3.0E-19
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 451 652 3.0E-19
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 451 652 3.0E-19
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 472 628 3.0E-19
sp|Q13106|ZN154_HUMAN Zinc finger protein 154 OS=Homo sapiens GN=ZNF154 PE=2 SV=3 468 614 3.0E-19
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 520 671 3.0E-19
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 520 650 3.0E-19
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 514 648 3.0E-19
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 512 640 3.0E-19
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 514 650 3.0E-19
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 472 650 3.0E-19
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 514 671 4.0E-19
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 514 650 4.0E-19
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 516 671 4.0E-19
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 514 628 4.0E-19
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 514 673 4.0E-19
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 468 614 4.0E-19
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 468 613 4.0E-19
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 468 648 4.0E-19
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 514 648 4.0E-19
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 511 637 4.0E-19
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 471 614 4.0E-19
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 514 638 4.0E-19
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 514 628 4.0E-19
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 466 637 4.0E-19
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 514 622 4.0E-19
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 472 628 4.0E-19
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 468 613 4.0E-19
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 514 648 4.0E-19
sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=1 SV=1 518 648 4.0E-19
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 613 4.0E-19
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 394 613 4.0E-19
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 501 646 4.0E-19
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 646 4.0E-19
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 451 637 4.0E-19
sp|Q6PF04|ZN613_HUMAN Zinc finger protein 613 OS=Homo sapiens GN=ZNF613 PE=2 SV=2 514 646 4.0E-19
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 468 648 4.0E-19
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 468 614 4.0E-19
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 518 648 4.0E-19
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 411 629 5.0E-19
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 514 650 5.0E-19
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 468 626 5.0E-19
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 394 650 5.0E-19
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 514 646 5.0E-19
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 472 637 5.0E-19
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 514 648 5.0E-19
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 514 671 5.0E-19
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 514 645 5.0E-19
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 522 646 5.0E-19
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 514 650 5.0E-19
sp|Q03923|ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens GN=ZNF85 PE=1 SV=3 468 613 5.0E-19
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 420 648 5.0E-19
sp|Q8N141|ZFP82_HUMAN Zinc finger protein 82 homolog OS=Homo sapiens GN=ZFP82 PE=2 SV=1 468 648 5.0E-19
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 468 646 5.0E-19
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 529 671 5.0E-19
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 514 650 5.0E-19
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 487 639 5.0E-19
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 468 621 6.0E-19
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 472 637 6.0E-19
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 514 641 6.0E-19
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 472 648 6.0E-19
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 516 671 6.0E-19
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 514 615 6.0E-19
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 468 648 6.0E-19
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 516 648 6.0E-19
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 514 650 6.0E-19
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 472 650 6.0E-19
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 472 648 6.0E-19
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 514 650 6.0E-19
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 468 646 7.0E-19
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 514 628 7.0E-19
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 468 628 7.0E-19
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 514 613 7.0E-19
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 520 646 7.0E-19
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 450 653 7.0E-19
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 514 648 7.0E-19
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 468 690 7.0E-19
sp|Q8N141|ZFP82_HUMAN Zinc finger protein 82 homolog OS=Homo sapiens GN=ZFP82 PE=2 SV=1 468 646 7.0E-19
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 514 646 7.0E-19
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 523 646 7.0E-19
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 468 616 7.0E-19
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 514 618 7.0E-19
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 479 646 7.0E-19
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 514 616 8.0E-19
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 531 677 8.0E-19
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 468 648 8.0E-19
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 472 671 8.0E-19
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 472 648 8.0E-19
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 514 613 8.0E-19
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 514 613 8.0E-19
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 508 651 8.0E-19
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 514 650 8.0E-19
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 513 640 8.0E-19
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 508 650 8.0E-19
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 472 622 8.0E-19
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 514 648 9.0E-19
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 514 648 9.0E-19
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 514 637 9.0E-19
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 491 646 9.0E-19
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 650 9.0E-19
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 530 673 9.0E-19
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 470 613 9.0E-19
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 472 614 9.0E-19
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 514 673 9.0E-19
sp|P18749|ZO6_XENLA Oocyte zinc finger protein XlCOF6 (Fragment) OS=Xenopus laevis PE=3 SV=1 514 641 9.0E-19
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 472 648 9.0E-19
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 472 615 1.0E-18
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 468 613 1.0E-18
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 514 615 1.0E-18
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 671 1.0E-18
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 518 671 1.0E-18
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 532 664 1.0E-18
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 468 650 1.0E-18
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 514 648 1.0E-18
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 514 673 1.0E-18
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 514 671 1.0E-18
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 472 646 1.0E-18
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 468 618 1.0E-18
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 531 646 1.0E-18
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 491 646 1.0E-18
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 472 646 1.0E-18
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 468 671 1.0E-18
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 472 646 1.0E-18
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 472 650 1.0E-18
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 472 619 1.0E-18
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 468 614 1.0E-18
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 468 614 1.0E-18
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 514 613 1.0E-18
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 468 614 1.0E-18
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 511 646 1.0E-18
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 394 650 1.0E-18
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 531 648 1.0E-18
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 514 618 1.0E-18
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 514 641 1.0E-18
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 472 650 1.0E-18
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 527 648 1.0E-18
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 514 648 1.0E-18
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 526 671 1.0E-18
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 513 646 1.0E-18
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 503 671 1.0E-18
sp|Q8N2I2|ZN619_HUMAN Zinc finger protein 619 OS=Homo sapiens GN=ZNF619 PE=2 SV=1 496 671 1.0E-18
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 501 677 1.0E-18
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 531 687 1.0E-18
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 472 620 1.0E-18
sp|Q802Y8|ZB16A_DANRE Zinc finger and BTB domain-containing protein 16-A OS=Danio rerio GN=zbtb16a PE=1 SV=1 465 648 1.0E-18
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 514 637 1.0E-18
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 510 650 1.0E-18
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 472 613 1.0E-18
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 514 643 1.0E-18
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 514 650 1.0E-18
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 472 667 1.0E-18
sp|Q68EA5|ZNF57_HUMAN Zinc finger protein 57 OS=Homo sapiens GN=ZNF57 PE=2 SV=3 468 638 1.0E-18
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 514 650 1.0E-18
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 468 646 2.0E-18
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 468 618 2.0E-18
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 519 665 2.0E-18
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 470 651 2.0E-18
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 470 651 2.0E-18
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 470 651 2.0E-18
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 472 644 2.0E-18
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 464 650 2.0E-18
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 516 651 2.0E-18
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 472 615 2.0E-18
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 468 650 2.0E-18
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 468 639 2.0E-18
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 511 671 2.0E-18
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 470 646 2.0E-18
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 511 671 2.0E-18
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 468 650 2.0E-18
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 514 640 2.0E-18
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 472 614 2.0E-18
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 514 671 2.0E-18
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 514 646 2.0E-18
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 506 650 2.0E-18
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 531 646 2.0E-18
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 523 671 2.0E-18
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 472 646 2.0E-18
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 514 618 2.0E-18
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 514 630 2.0E-18
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 514 639 2.0E-18
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 472 613 2.0E-18
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 514 646 2.0E-18
sp|B2RXC5|ZN382_MOUSE Zinc finger protein 382 OS=Mus musculus GN=Znf382 PE=1 SV=1 472 646 2.0E-18
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 512 650 2.0E-18
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 514 637 2.0E-18
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 514 687 2.0E-18
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 371 648 2.0E-18
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 513 646 2.0E-18
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 514 650 2.0E-18
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 514 637 2.0E-18
sp|Q8TA94|ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens GN=ZNF563 PE=2 SV=1 514 648 2.0E-18
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 522 650 2.0E-18
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 514 671 2.0E-18
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 450 653 2.0E-18
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 450 653 2.0E-18
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 529 646 2.0E-18
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 514 647 2.0E-18
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 520 650 2.0E-18
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 470 637 2.0E-18
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 472 648 2.0E-18
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 428 653 2.0E-18
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 514 646 2.0E-18
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 472 646 2.0E-18
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 514 639 2.0E-18
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 395 637 2.0E-18
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 468 628 2.0E-18
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 514 646 2.0E-18
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 514 671 3.0E-18
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 468 613 3.0E-18
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 470 651 3.0E-18
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 518 671 3.0E-18
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 528 646 3.0E-18
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 468 629 3.0E-18
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 520 646 3.0E-18
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 472 646 3.0E-18
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 468 670 3.0E-18
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 514 648 3.0E-18
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 514 646 3.0E-18
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 472 650 3.0E-18
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 468 650 3.0E-18
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 514 673 3.0E-18
sp|Q8N141|ZFP82_HUMAN Zinc finger protein 82 homolog OS=Homo sapiens GN=ZFP82 PE=2 SV=1 468 648 3.0E-18
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 468 673 3.0E-18
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 472 637 3.0E-18
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 514 650 3.0E-18
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 514 648 3.0E-18
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 518 648 3.0E-18
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 408 646 3.0E-18
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 472 650 3.0E-18
sp|Q9Y2G7|ZFP30_HUMAN Zinc finger protein 30 homolog OS=Homo sapiens GN=ZFP30 PE=2 SV=1 523 648 3.0E-18
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 514 628 3.0E-18
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 516 651 4.0E-18
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 468 637 4.0E-18
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 470 613 4.0E-18
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 468 650 4.0E-18
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 472 673 4.0E-18
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 472 673 4.0E-18
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 514 650 4.0E-18
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 486 650 4.0E-18
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 472 640 4.0E-18
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 470 671 4.0E-18
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 468 637 4.0E-18
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 514 614 4.0E-18
sp|P17019|ZN708_HUMAN Zinc finger protein 708 OS=Homo sapiens GN=ZNF708 PE=1 SV=5 514 622 4.0E-18
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 519 650 4.0E-18
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 514 637 4.0E-18
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 514 650 4.0E-18
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 514 626 4.0E-18
sp|Q9NQX6|ZN331_HUMAN Zinc finger protein 331 OS=Homo sapiens GN=ZNF331 PE=1 SV=1 522 671 4.0E-18
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 522 646 4.0E-18
sp|Q8IVP9|ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens GN=ZNF547 PE=2 SV=2 468 628 4.0E-18
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 447 671 4.0E-18
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 487 620 4.0E-18
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 408 646 4.0E-18
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 509 646 4.0E-18
sp|Q802Y8|ZB16A_DANRE Zinc finger and BTB domain-containing protein 16-A OS=Danio rerio GN=zbtb16a PE=1 SV=1 472 671 4.0E-18
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 472 650 4.0E-18
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 514 646 4.0E-18
sp|Q5RCX4|ZN547_PONAB Zinc finger protein 547 OS=Pongo abelii GN=ZNF547 PE=2 SV=1 426 628 4.0E-18
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 468 650 4.0E-18
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 472 641 4.0E-18
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 468 613 5.0E-18
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 471 613 5.0E-18
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 522 646 5.0E-18
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 522 641 5.0E-18
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 472 613 5.0E-18
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 468 671 5.0E-18
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 468 646 5.0E-18
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 487 624 5.0E-18
sp|Q5REA0|ZN331_PONAB Zinc finger protein 331 OS=Pongo abelii GN=ZNF331 PE=2 SV=1 522 671 5.0E-18
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 520 650 5.0E-18
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 509 646 5.0E-18
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 535 646 5.0E-18
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 472 650 5.0E-18
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 386 614 6.0E-18
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 514 634 6.0E-18
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 514 618 6.0E-18
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 514 639 6.0E-18
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 514 650 6.0E-18
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 513 646 6.0E-18
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 514 634 6.0E-18
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 513 625 6.0E-18
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 514 650 6.0E-18
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 468 615 7.0E-18
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 472 621 7.0E-18
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 524 671 7.0E-18
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 468 646 7.0E-18
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 514 648 7.0E-18
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 470 646 7.0E-18
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 514 648 7.0E-18
sp|Q9Y2G7|ZFP30_HUMAN Zinc finger protein 30 homolog OS=Homo sapiens GN=ZFP30 PE=2 SV=1 514 648 7.0E-18
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 468 671 8.0E-18
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 472 650 8.0E-18
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 511 615 8.0E-18
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 389 648 8.0E-18
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 514 648 8.0E-18
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 472 638 8.0E-18
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 433 646 8.0E-18
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 501 658 8.0E-18
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 514 650 8.0E-18
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 646 9.0E-18
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 468 637 9.0E-18
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 471 613 9.0E-18
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 468 614 9.0E-18
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 514 646 9.0E-18
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 513 651 9.0E-18
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 514 646 9.0E-18
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 518 650 9.0E-18
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 514 616 1.0E-17
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 472 613 1.0E-17
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 468 614 1.0E-17
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 468 614 1.0E-17
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 514 646 1.0E-17
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 523 646 1.0E-17
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 468 637 1.0E-17
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 472 665 1.0E-17
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 514 677 1.0E-17
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 450 646 1.0E-17
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 450 646 1.0E-17
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 501 644 1.0E-17
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 514 648 1.0E-17
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 514 650 1.0E-17
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 468 613 1.0E-17
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 514 628 1.0E-17
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 513 615 1.0E-17
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 513 615 1.0E-17
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 514 650 1.0E-17
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 514 646 1.0E-17
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 514 646 1.0E-17
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 514 646 1.0E-17
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 514 646 1.0E-17
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 514 646 1.0E-17
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 468 648 1.0E-17
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 472 651 1.0E-17
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 468 648 1.0E-17
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 514 648 1.0E-17
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 514 637 1.0E-17
sp|Q8N141|ZFP82_HUMAN Zinc finger protein 82 homolog OS=Homo sapiens GN=ZFP82 PE=2 SV=1 514 646 1.0E-17
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 395 650 1.0E-17
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 646 1.0E-17
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 468 614 1.0E-17
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 518 650 1.0E-17
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 470 639 1.0E-17
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 527 671 1.0E-17
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 514 614 2.0E-17
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 531 646 2.0E-17
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 468 613 2.0E-17
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 468 614 2.0E-17
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 468 614 2.0E-17
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 531 648 2.0E-17
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 514 637 2.0E-17
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 514 650 2.0E-17
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 513 637 2.0E-17
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 514 637 2.0E-17
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 395 613 2.0E-17
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 472 665 2.0E-17
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 470 638 2.0E-17
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 525 671 2.0E-17
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 514 650 2.0E-17
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 514 677 2.0E-17
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 535 650 2.0E-17
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 538 646 2.0E-17
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 514 648 2.0E-17
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 472 628 2.0E-17
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 529 650 2.0E-17
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 529 650 2.0E-17
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 529 650 2.0E-17
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 529 650 2.0E-17
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 529 650 2.0E-17
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 472 613 2.0E-17
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 529 650 2.0E-17
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 514 646 2.0E-17
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 468 614 2.0E-17
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 514 687 2.0E-17
sp|Q8TA94|ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens GN=ZNF563 PE=2 SV=1 468 644 2.0E-17
sp|Q96NJ3|ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens GN=ZNF285 PE=2 SV=2 516 646 2.0E-17
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 472 614 2.0E-17
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 470 618 2.0E-17
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 514 646 2.0E-17
sp|Q5R5Q6|ZN571_PONAB Zinc finger protein 571 OS=Pongo abelii GN=ZNF571 PE=2 SV=1 472 646 2.0E-17
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 514 646 2.0E-17
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 514 671 2.0E-17
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 468 616 2.0E-17
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 514 671 2.0E-17
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 514 650 2.0E-17
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 514 637 3.0E-17
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 514 650 3.0E-17
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 468 637 3.0E-17
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 514 650 3.0E-17
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 527 637 3.0E-17
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 468 671 3.0E-17
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 515 650 3.0E-17
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 468 654 3.0E-17
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 514 613 3.0E-17
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 529 646 3.0E-17
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 468 648 3.0E-17
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 468 621 3.0E-17
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 468 648 3.0E-17
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 514 637 3.0E-17
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 514 650 3.0E-17
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 520 650 3.0E-17
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 526 646 4.0E-17
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 472 628 4.0E-17
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 526 646 4.0E-17
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 468 650 4.0E-17
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 468 616 4.0E-17
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 526 646 4.0E-17
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 468 637 4.0E-17
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 514 650 4.0E-17
sp|Q8N141|ZFP82_HUMAN Zinc finger protein 82 homolog OS=Homo sapiens GN=ZFP82 PE=2 SV=1 514 616 4.0E-17
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 501 646 4.0E-17
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 531 676 4.0E-17
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 468 647 4.0E-17
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 531 648 4.0E-17
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 514 651 4.0E-17
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 514 646 4.0E-17
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 472 637 4.0E-17
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 514 650 5.0E-17
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 472 628 5.0E-17
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 468 613 5.0E-17
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 531 671 5.0E-17
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 508 671 5.0E-17
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 514 648 6.0E-17
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 516 650 6.0E-17
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 472 625 6.0E-17
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 470 637 6.0E-17
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 520 646 6.0E-17
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 514 696 6.0E-17
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 514 646 6.0E-17
sp|Q7Z3V5|ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens GN=ZNF571 PE=2 SV=3 468 614 6.0E-17
sp|Q5RCX4|ZN547_PONAB Zinc finger protein 547 OS=Pongo abelii GN=ZNF547 PE=2 SV=1 472 614 6.0E-17
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 468 627 6.0E-17
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 472 613 6.0E-17
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 518 648 7.0E-17
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 514 646 7.0E-17
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 514 671 7.0E-17
sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens GN=ZNF20 PE=1 SV=2 523 648 7.0E-17
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 468 647 7.0E-17
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 508 648 7.0E-17
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 468 623 8.0E-17
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 472 616 8.0E-17
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 514 615 8.0E-17
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 514 646 8.0E-17
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 525 648 8.0E-17
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 514 637 8.0E-17
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 514 650 8.0E-17
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 468 613 9.0E-17
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 514 646 9.0E-17
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 472 651 9.0E-17
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 472 613 9.0E-17
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 514 646 9.0E-17
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 514 671 9.0E-17
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 514 646 1.0E-16
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 514 613 1.0E-16
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 470 637 1.0E-16
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 504 648 1.0E-16
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 528 671 1.0E-16
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 472 611 1.0E-16
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 531 671 1.0E-16
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 514 650 1.0E-16
sp|Q9Y2P7|ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens GN=ZNF256 PE=1 SV=2 514 671 1.0E-16
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 451 671 1.0E-16
sp|O60765|Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens GN=ZNF354A PE=2 SV=2 393 637 1.0E-16
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 489 671 1.0E-16
sp|Q8TF68|ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens GN=ZNF384 PE=1 SV=2 501 648 1.0E-16
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 509 688 1.0E-16
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 488 671 1.0E-16
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 472 671 1.0E-16
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 514 648 1.0E-16
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 531 650 1.0E-16
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 501 646 1.0E-16
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 470 646 1.0E-16
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 468 646 1.0E-16
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 472 648 1.0E-16
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 472 637 1.0E-16
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 495 650 1.0E-16
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 526 677 2.0E-16
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 470 646 2.0E-16
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 528 650 2.0E-16
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 504 648 2.0E-16
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 514 648 2.0E-16
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 514 650 2.0E-16
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 468 614 2.0E-16
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 468 637 2.0E-16
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 527 650 2.0E-16
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 514 646 2.0E-16
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 514 646 2.0E-16
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 514 646 2.0E-16
sp|Q9EQJ4|ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus GN=Znf384 PE=1 SV=1 501 648 2.0E-16
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 520 623 2.0E-16
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 510 641 2.0E-16
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 472 646 2.0E-16
sp|Q8IVP9|ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens GN=ZNF547 PE=2 SV=2 514 637 2.0E-16
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 514 646 2.0E-16
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 468 628 2.0E-16
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 514 637 2.0E-16
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 501 646 2.0E-16
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 468 614 2.0E-16
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 468 637 2.0E-16
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 525 626 2.0E-16
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 471 671 2.0E-16
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 531 685 2.0E-16
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 532 646 2.0E-16
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 513 614 2.0E-16
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 535 671 2.0E-16
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 451 614 2.0E-16
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 514 648 2.0E-16
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 535 646 2.0E-16
sp|O95780|ZN682_HUMAN Zinc finger protein 682 OS=Homo sapiens GN=ZNF682 PE=2 SV=1 514 634 2.0E-16
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 526 646 3.0E-16
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 531 684 3.0E-16
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 514 671 3.0E-16
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 501 646 3.0E-16
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 520 655 3.0E-16
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 525 626 3.0E-16
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 501 646 3.0E-16
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 391 677 3.0E-16
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 444 673 3.0E-16
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 516 646 3.0E-16
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 514 650 3.0E-16
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 472 628 3.0E-16
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 468 646 3.0E-16
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 514 646 3.0E-16
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 522 653 3.0E-16
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 522 653 3.0E-16
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 514 648 3.0E-16
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 526 646 4.0E-16
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 515 650 4.0E-16
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 472 613 4.0E-16
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 488 648 4.0E-16
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 523 673 4.0E-16
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 468 634 4.0E-16
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 531 677 4.0E-16
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 514 671 4.0E-16
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 514 651 4.0E-16
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 472 613 4.0E-16
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 523 671 4.0E-16
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 514 648 4.0E-16
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 444 673 4.0E-16
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 468 613 4.0E-16
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 514 613 4.0E-16
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 535 646 4.0E-16
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 501 650 4.0E-16
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 535 646 4.0E-16
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 462 616 4.0E-16
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 526 646 5.0E-16
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 531 671 5.0E-16
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 535 684 5.0E-16
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 523 673 5.0E-16
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 522 650 5.0E-16
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 514 626 5.0E-16
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 500 646 5.0E-16
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 513 643 5.0E-16
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 535 648 5.0E-16
sp|Q9Y2G7|ZFP30_HUMAN Zinc finger protein 30 homolog OS=Homo sapiens GN=ZFP30 PE=2 SV=1 514 615 5.0E-16
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 531 648 6.0E-16
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 514 651 6.0E-16
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 472 613 6.0E-16
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 514 650 6.0E-16
sp|Q8TA94|ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens GN=ZNF563 PE=2 SV=1 472 646 6.0E-16
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 510 646 6.0E-16
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 511 628 6.0E-16
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 514 650 7.0E-16
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 493 671 7.0E-16
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 472 646 7.0E-16
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 518 646 7.0E-16
sp|Q8IVP9|ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens GN=ZNF547 PE=2 SV=2 517 646 7.0E-16
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 501 650 7.0E-16
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 513 651 7.0E-16
sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens GN=ZNF20 PE=1 SV=2 514 615 7.0E-16
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 514 673 7.0E-16
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 514 648 7.0E-16
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 516 671 8.0E-16
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 468 618 8.0E-16
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 468 647 8.0E-16
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 460 648 8.0E-16
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 490 673 8.0E-16
sp|Q9NXT0|ZN586_HUMAN Zinc finger protein 586 OS=Homo sapiens GN=ZNF586 PE=2 SV=2 511 648 8.0E-16
sp|Q8TAF7|ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens GN=ZNF461 PE=2 SV=2 520 648 9.0E-16
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 514 657 9.0E-16
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 472 613 1.0E-15
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 451 648 1.0E-15
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 514 613 1.0E-15
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 523 648 1.0E-15
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 531 650 1.0E-15
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 529 673 1.0E-15
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 472 613 1.0E-15
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 468 614 1.0E-15
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 468 634 1.0E-15
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 468 614 1.0E-15
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 528 673 1.0E-15
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 528 646 1.0E-15
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 472 651 1.0E-15
sp|Q8IVP9|ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens GN=ZNF547 PE=2 SV=2 472 614 1.0E-15
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 513 646 1.0E-15
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 490 673 1.0E-15
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 525 671 1.0E-15
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 422 671 1.0E-15
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 514 671 1.0E-15
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 531 650 1.0E-15
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 514 648 2.0E-15
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 468 671 2.0E-15
sp|Q05516|ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens GN=ZBTB16 PE=1 SV=2 465 648 2.0E-15
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 472 623 2.0E-15
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 529 646 2.0E-15
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 447 646 2.0E-15
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 534 650 2.0E-15
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 472 641 2.0E-15
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 514 637 2.0E-15
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 539 650 2.0E-15
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 516 646 2.0E-15
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 468 613 2.0E-15
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 514 650 2.0E-15
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 472 611 2.0E-15
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 514 650 2.0E-15
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 525 671 3.0E-15
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 514 637 3.0E-15
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 470 591 3.0E-15
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 468 665 3.0E-15
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 468 618 3.0E-15
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 514 650 3.0E-15
sp|O60765|Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens GN=ZNF354A PE=2 SV=2 528 650 3.0E-15
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 525 650 3.0E-15
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 468 638 3.0E-15
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 468 613 3.0E-15
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 514 646 3.0E-15
sp|Q9Y2G7|ZFP30_HUMAN Zinc finger protein 30 homolog OS=Homo sapiens GN=ZFP30 PE=2 SV=1 514 646 3.0E-15
sp|Q68EA5|ZNF57_HUMAN Zinc finger protein 57 OS=Homo sapiens GN=ZNF57 PE=2 SV=3 514 628 3.0E-15
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 532 701 4.0E-15
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 525 648 4.0E-15
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 531 646 4.0E-15
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 472 646 4.0E-15
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 472 613 4.0E-15
sp|Q15928|ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens GN=ZNF141 PE=1 SV=1 527 646 4.0E-15
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 514 651 4.0E-15
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 531 641 4.0E-15
sp|P51504|ZNF80_HUMAN Zinc finger protein 80 OS=Homo sapiens GN=ZNF80 PE=2 SV=2 514 628 4.0E-15
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 514 616 4.0E-15
sp|Q9Y2G7|ZFP30_HUMAN Zinc finger protein 30 homolog OS=Homo sapiens GN=ZFP30 PE=2 SV=1 514 637 4.0E-15
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 450 646 5.0E-15
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 514 613 5.0E-15
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 514 613 5.0E-15
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 514 650 5.0E-15
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 525 671 5.0E-15
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 472 614 5.0E-15
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 613 5.0E-15
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 529 650 6.0E-15
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 472 646 6.0E-15
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 508 628 7.0E-15
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 531 646 7.0E-15
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 514 613 7.0E-15
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 514 613 7.0E-15
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 514 613 8.0E-15
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 535 646 8.0E-15
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 514 645 8.0E-15
sp|Q969W8|ZN566_HUMAN Zinc finger protein 566 OS=Homo sapiens GN=ZNF566 PE=2 SV=1 514 610 9.0E-15
sp|Q6J6I6|ZN566_PANTR Zinc finger protein 566 OS=Pan troglodytes GN=ZNF566 PE=2 SV=1 514 610 9.0E-15
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 532 648 9.0E-15
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 531 650 9.0E-15
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 525 650 9.0E-15
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 472 650 9.0E-15
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 514 650 9.0E-15
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 468 613 9.0E-15
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 468 613 1.0E-14
sp|Q5SXM1|ZN678_HUMAN Zinc finger protein 678 OS=Homo sapiens GN=ZNF678 PE=2 SV=1 528 671 1.0E-14
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 514 628 1.0E-14
sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 535 650 1.0E-14
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 525 650 1.0E-14
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 514 645 1.0E-14
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 526 648 1.0E-14
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 493 671 1.0E-14
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 514 618 1.0E-14
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 522 671 1.0E-14
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 514 614 1.0E-14
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 514 663 1.0E-14
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 501 648 1.0E-14
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 495 648 1.0E-14
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 470 648 2.0E-14
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 468 637 2.0E-14
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 535 637 2.0E-14
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 529 648 2.0E-14
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 514 685 2.0E-14
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 529 648 2.0E-14
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 526 650 2.0E-14
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 472 613 2.0E-14
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 472 646 2.0E-14
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 525 648 2.0E-14
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 472 646 2.0E-14
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 514 613 2.0E-14
sp|Q9H707|ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens GN=ZNF552 PE=1 SV=2 501 648 2.0E-14
sp|Q7ZVR6|MYNN_DANRE Myoneurin OS=Danio rerio GN=mynn PE=2 SV=1 472 614 2.0E-14
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 501 648 2.0E-14
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 514 650 3.0E-14
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 531 646 3.0E-14
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 504 650 3.0E-14
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 472 602 3.0E-14
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 527 646 3.0E-14
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 514 628 3.0E-14
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 514 650 4.0E-14
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 535 646 4.0E-14
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 472 612 4.0E-14
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 541 673 4.0E-14
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 468 613 4.0E-14
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 468 648 4.0E-14
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 490 650 4.0E-14
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 531 646 4.0E-14
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 468 614 4.0E-14
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 541 646 4.0E-14
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 527 646 4.0E-14
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 671 5.0E-14
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 472 612 5.0E-14
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 524 648 5.0E-14
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 514 648 5.0E-14
sp|P51507|ZNF80_PONPY Zinc finger protein 80 OS=Pongo pygmaeus GN=ZNF80 PE=3 SV=1 472 621 5.0E-14
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 514 589 5.0E-14
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 514 589 5.0E-14
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 514 636 5.0E-14
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 472 634 5.0E-14
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 538 639 5.0E-14
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 472 597 6.0E-14
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 472 646 6.0E-14
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 472 650 6.0E-14
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 514 589 6.0E-14
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 531 650 6.0E-14
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 468 593 7.0E-14
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 468 595 7.0E-14
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 472 613 7.0E-14
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 472 646 7.0E-14
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 470 591 7.0E-14
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 531 687 8.0E-14
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 472 628 9.0E-14
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 514 650 9.0E-14
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 472 650 9.0E-14
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 501 650 9.0E-14
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 514 660 9.0E-14
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 514 650 9.0E-14
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 531 650 9.0E-14
sp|Q2M218|ZN630_HUMAN Zinc finger protein 630 OS=Homo sapiens GN=ZNF630 PE=2 SV=1 472 628 9.0E-14
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 514 673 1.0E-13
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 470 648 1.0E-13
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 531 646 1.0E-13
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 535 648 1.0E-13
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 514 648 1.0E-13
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 474 637 1.0E-13
sp|O75437|ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens GN=ZNF254 PE=2 SV=3 472 613 1.0E-13
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 491 643 1.0E-13
sp|P10751|ZFP11_MOUSE Zinc finger protein 11 OS=Mus musculus GN=Zfp11 PE=2 SV=2 547 646 1.0E-13
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 528 681 1.0E-13
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 514 650 1.0E-13
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 468 671 2.0E-13
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 514 618 2.0E-13
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 470 671 2.0E-13
sp|Q3SY52|ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens GN=ZIK1 PE=2 SV=1 538 648 2.0E-13
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 472 650 2.0E-13
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 514 613 2.0E-13
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 506 646 2.0E-13
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 514 646 2.0E-13
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 509 651 2.0E-13
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 514 687 2.0E-13
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 524 650 2.0E-13
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 531 650 2.0E-13
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 531 646 2.0E-13
sp|Q68EA5|ZNF57_HUMAN Zinc finger protein 57 OS=Homo sapiens GN=ZNF57 PE=2 SV=3 468 608 2.0E-13
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 529 650 3.0E-13
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 472 587 3.0E-13
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 472 591 3.0E-13
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 518 613 3.0E-13
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 514 646 3.0E-13
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 526 650 3.0E-13
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 470 613 3.0E-13
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 539 671 4.0E-13
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 514 648 4.0E-13
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 527 684 4.0E-13
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 514 613 4.0E-13
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 522 645 4.0E-13
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 526 688 4.0E-13
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 514 673 5.0E-13
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 514 673 5.0E-13
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 514 589 5.0E-13
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 388 613 5.0E-13
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 518 622 6.0E-13
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 514 650 6.0E-13
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 514 685 6.0E-13
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 514 614 6.0E-13
sp|Q13105|ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens GN=ZBTB17 PE=1 SV=3 535 650 6.0E-13
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 470 628 6.0E-13
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 554 671 7.0E-13
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 522 648 7.0E-13
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 515 648 7.0E-13
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 514 671 7.0E-13
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 491 643 7.0E-13
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 539 671 8.0E-13
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 509 621 8.0E-13
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 514 606 9.0E-13
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 514 650 9.0E-13
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 531 648 9.0E-13
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 468 628 9.0E-13
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 505 648 9.0E-13
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 503 613 9.0E-13
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 558 673 1.0E-12
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 514 650 1.0E-12
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 553 650 1.0E-12
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 514 650 1.0E-12
sp|Q8N2I2|ZN619_HUMAN Zinc finger protein 619 OS=Homo sapiens GN=ZNF619 PE=2 SV=1 468 618 1.0E-12
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 470 591 1.0E-12
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 514 613 1.0E-12
sp|P51504|ZNF80_HUMAN Zinc finger protein 80 OS=Homo sapiens GN=ZNF80 PE=2 SV=2 514 614 1.0E-12
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 522 671 1.0E-12
sp|Q80YP6|ZIK1_MOUSE Zinc finger protein interacting with ribonucleoprotein K OS=Mus musculus GN=Zik1 PE=1 SV=1 538 648 2.0E-12
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 468 591 2.0E-12
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 472 588 2.0E-12
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 514 650 2.0E-12
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 468 589 2.0E-12
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 518 688 2.0E-12
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 524 652 2.0E-12
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 525 687 2.0E-12
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 525 687 2.0E-12
sp|A6NK75|ZNF98_HUMAN Zinc finger protein 98 OS=Homo sapiens GN=ZNF98 PE=2 SV=4 472 611 2.0E-12
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 531 650 2.0E-12
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 531 651 2.0E-12
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 514 640 2.0E-12
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 531 671 2.0E-12
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 535 646 2.0E-12
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 522 637 2.0E-12
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 520 671 2.0E-12
sp|Q96SQ5|ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens GN=ZNF587 PE=1 SV=1 494 671 2.0E-12
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 520 628 2.0E-12
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 646 3.0E-12
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 470 589 3.0E-12
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 468 644 3.0E-12
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 425 606 3.0E-12
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 514 650 3.0E-12
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 514 652 3.0E-12
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 520 634 3.0E-12
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 523 648 3.0E-12
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 539 671 3.0E-12
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 512 682 3.0E-12
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 514 671 3.0E-12
sp|Q8N141|ZFP82_HUMAN Zinc finger protein 82 homolog OS=Homo sapiens GN=ZFP82 PE=2 SV=1 540 673 3.0E-12
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 514 651 3.0E-12
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 514 614 3.0E-12
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 468 613 3.0E-12
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 532 701 4.0E-12
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 514 671 4.0E-12
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 556 648 4.0E-12
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 554 648 4.0E-12
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 535 650 4.0E-12
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 514 690 4.0E-12
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 520 646 4.0E-12
sp|Q5JVG8|ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens GN=ZNF506 PE=2 SV=2 522 650 4.0E-12
sp|Q9Y2G7|ZFP30_HUMAN Zinc finger protein 30 homolog OS=Homo sapiens GN=ZFP30 PE=2 SV=1 547 671 4.0E-12
sp|Q68EA5|ZNF57_HUMAN Zinc finger protein 57 OS=Homo sapiens GN=ZNF57 PE=2 SV=3 508 648 4.0E-12
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 426 586 5.0E-12
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 470 671 5.0E-12
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 468 597 5.0E-12
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 531 648 5.0E-12
sp|Q8N782|ZN525_HUMAN Zinc finger protein 525 OS=Homo sapiens GN=ZNF525 PE=2 SV=2 514 601 5.0E-12
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 548 648 6.0E-12
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 470 591 6.0E-12
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 556 650 7.0E-12
sp|Q9VI93|RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster GN=rn PE=1 SV=2 535 651 7.0E-12
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 514 650 7.0E-12
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 468 645 8.0E-12
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 540 650 8.0E-12
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 553 648 8.0E-12
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 514 650 8.0E-12
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 514 638 9.0E-12
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 468 616 9.0E-12
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 550 671 9.0E-12
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 474 671 9.0E-12
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 535 684 9.0E-12
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 468 590 9.0E-12
sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 514 587 9.0E-12
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 535 685 1.0E-11
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 558 648 1.0E-11
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 527 665 1.0E-11
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 472 613 1.0E-11
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 472 613 1.0E-11
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 514 648 1.0E-11
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 523 637 1.0E-11
sp|A1YEP8|ZSC12_GORGO Zinc finger and SCAN domain-containing protein 12 OS=Gorilla gorilla gorilla GN=ZSCAN12 PE=3 SV=1 535 642 1.0E-11
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 472 616 1.0E-11
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 501 628 1.0E-11
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 472 585 1.0E-11
sp|Q03924|ZN117_HUMAN Zinc finger protein 117 OS=Homo sapiens GN=ZNF117 PE=2 SV=5 514 637 1.0E-11
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 529 671 1.0E-11
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 514 628 1.0E-11
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 472 588 2.0E-11
sp|Q9NX65|ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens GN=ZSCAN32 PE=1 SV=3 562 646 2.0E-11
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 468 591 2.0E-11
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 514 634 2.0E-11
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 535 671 2.0E-11
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 468 586 2.0E-11
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 472 589 2.0E-11
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 470 671 2.0E-11
sp|O43309|ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens GN=ZSCAN12 PE=1 SV=1 535 642 2.0E-11
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 535 642 2.0E-11
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 535 642 2.0E-11
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 514 648 2.0E-11
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 549 650 2.0E-11
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 468 587 2.0E-11
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 525 650 2.0E-11
sp|Q99684|GFI1_HUMAN Zinc finger protein Gfi-1 OS=Homo sapiens GN=GFI1 PE=1 SV=2 535 646 2.0E-11
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 518 628 2.0E-11
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 472 589 3.0E-11
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 514 588 3.0E-11
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 535 671 3.0E-11
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 535 671 3.0E-11
sp|P51507|ZNF80_PONPY Zinc finger protein 80 OS=Pongo pygmaeus GN=ZNF80 PE=3 SV=1 451 614 3.0E-11
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 472 586 3.0E-11
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 468 591 3.0E-11
sp|Q802Y8|ZB16A_DANRE Zinc finger and BTB domain-containing protein 16-A OS=Danio rerio GN=zbtb16a PE=1 SV=1 514 638 3.0E-11
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 514 611 3.0E-11
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 468 650 4.0E-11
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 507 591 4.0E-11
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 472 591 4.0E-11
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 468 586 4.0E-11
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 514 589 4.0E-11
sp|Q6PK81|ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens GN=ZNF773 PE=2 SV=1 514 588 4.0E-11
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 514 614 5.0E-11
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 562 671 5.0E-11
sp|Q8TAF7|ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens GN=ZNF461 PE=2 SV=2 514 591 5.0E-11
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 514 651 5.0E-11
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 471 614 5.0E-11
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 535 646 5.0E-11
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 514 591 5.0E-11
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 468 588 5.0E-11
sp|Q9P255|ZN492_HUMAN Zinc finger protein 492 OS=Homo sapiens GN=ZNF492 PE=2 SV=2 472 611 5.0E-11
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 522 648 5.0E-11
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 514 671 6.0E-11
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 468 586 6.0E-11
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 514 613 6.0E-11
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 514 671 6.0E-11
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 568 671 6.0E-11
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 514 613 6.0E-11
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 525 648 6.0E-11
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 505 671 6.0E-11
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 522 648 6.0E-11
sp|P41183|BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus GN=Bcl6 PE=1 SV=1 535 649 6.0E-11
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 468 591 7.0E-11
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 541 648 7.0E-11
sp|P41182|BCL6_HUMAN B-cell lymphoma 6 protein OS=Homo sapiens GN=BCL6 PE=1 SV=1 535 649 7.0E-11
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 471 589 8.0E-11
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 468 588 8.0E-11
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 535 671 8.0E-11
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 514 648 9.0E-11
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 535 671 9.0E-11
sp|A2T6V8|ZSC12_PANTR Zinc finger and SCAN domain-containing protein 12 OS=Pan troglodytes GN=ZSCAN12 PE=3 SV=1 535 642 9.0E-11
sp|Q8N2I2|ZN619_HUMAN Zinc finger protein 619 OS=Homo sapiens GN=ZNF619 PE=2 SV=1 468 591 9.0E-11
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 514 673 9.0E-11
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 512 671 1.0E-10
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 558 648 1.0E-10
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 514 648 1.0E-10
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 468 587 1.0E-10
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 514 587 1.0E-10
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 514 601 1.0E-10
sp|P10755|ZFP14_MOUSE Zinc finger protein 14 OS=Mus musculus GN=Zfp14 PE=2 SV=2 514 587 1.0E-10
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 542 648 1.0E-10
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 488 651 1.0E-10
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 543 650 1.0E-10
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 470 588 1.0E-10
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 528 646 1.0E-10
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 514 589 2.0E-10
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 546 648 2.0E-10
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 502 586 2.0E-10
sp|Q05516|ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens GN=ZBTB16 PE=1 SV=2 514 650 2.0E-10
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 468 586 2.0E-10
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 514 595 2.0E-10
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 470 596 2.0E-10
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 476 650 2.0E-10
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 472 586 2.0E-10
sp|A0JPL0|ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus GN=Znf382 PE=1 SV=1 539 648 2.0E-10
sp|Q9NZL3|ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens GN=ZNF224 PE=1 SV=3 528 671 2.0E-10
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 520 648 2.0E-10
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 491 643 2.0E-10
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 468 591 2.0E-10
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 514 646 3.0E-10
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 532 637 3.0E-10
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 468 589 3.0E-10
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 468 586 3.0E-10
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 468 587 3.0E-10
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 468 586 3.0E-10
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 468 586 3.0E-10
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 468 586 3.0E-10
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 547 650 3.0E-10
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 562 671 3.0E-10
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 539 642 3.0E-10
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 538 646 3.0E-10
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 522 646 3.0E-10
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 514 589 3.0E-10
sp|Q8NEM1|ZN680_HUMAN Zinc finger protein 680 OS=Homo sapiens GN=ZNF680 PE=2 SV=2 472 600 3.0E-10
sp|O75373|ZN737_HUMAN Zinc finger protein 737 OS=Homo sapiens GN=ZNF737 PE=2 SV=3 514 589 3.0E-10
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 395 589 3.0E-10
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 468 586 4.0E-10
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 568 650 4.0E-10
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 470 596 4.0E-10
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 529 648 4.0E-10
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 514 595 4.0E-10
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 548 650 4.0E-10
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 548 648 5.0E-10
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 518 646 5.0E-10
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 514 651 5.0E-10
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 574 701 5.0E-10
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 472 645 5.0E-10
sp|Q6ZNG0|ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens GN=ZNF620 PE=2 SV=1 528 628 5.0E-10
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 524 646 6.0E-10
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 514 648 6.0E-10
sp|P51786|ZN157_HUMAN Zinc finger protein 157 OS=Homo sapiens GN=ZNF157 PE=2 SV=2 514 587 6.0E-10
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 473 650 6.0E-10
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 555 638 7.0E-10
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 568 648 7.0E-10
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 513 591 7.0E-10
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 472 614 7.0E-10
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 470 646 8.0E-10
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 531 671 9.0E-10
sp|Q6JLC9|ZN331_CANLF Zinc finger protein 331 OS=Canis lupus familiaris GN=ZNF331 PE=2 SV=1 472 592 9.0E-10
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 545 671 9.0E-10
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 523 648 1.0E-09
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 514 671 1.0E-09
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 468 586 1.0E-09
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 468 606 1.0E-09
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 514 589 1.0E-09
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 468 589 1.0E-09
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 514 589 1.0E-09
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 472 586 1.0E-09
sp|P47043|ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZAP1 PE=1 SV=1 536 648 2.0E-09
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 468 587 2.0E-09
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 535 684 2.0E-09
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 468 586 2.0E-09
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 522 646 2.0E-09
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 514 589 2.0E-09
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 468 592 2.0E-09
sp|Q02975|Z354A_RAT Zinc finger protein 354A OS=Rattus norvegicus GN=Znf354a PE=2 SV=1 470 590 2.0E-09
sp|P38621|ZN12_MICSA Zinc finger protein ZFMSA12A OS=Micropterus salmoides PE=2 SV=1 496 637 2.0E-09
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 518 591 2.0E-09
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 531 671 2.0E-09
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 472 593 2.0E-09
sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=4 472 590 2.0E-09
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 472 589 3.0E-09
sp|Q96H86|ZN764_HUMAN Zinc finger protein 764 OS=Homo sapiens GN=ZNF764 PE=2 SV=2 568 665 3.0E-09
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 514 650 3.0E-09
sp|Q96SR6|ZN382_HUMAN Zinc finger protein 382 OS=Homo sapiens GN=ZNF382 PE=2 SV=3 514 648 3.0E-09
sp|Q8IVP9|ZN547_HUMAN Zinc finger protein 547 OS=Homo sapiens GN=ZNF547 PE=2 SV=2 553 671 3.0E-09
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 525 646 3.0E-09
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 518 589 3.0E-09
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 472 589 4.0E-09
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 545 671 4.0E-09
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 556 646 4.0E-09
sp|B4DXR9|ZN732_HUMAN Zinc finger protein 732 OS=Homo sapiens GN=ZNF732 PE=2 SV=1 514 589 4.0E-09
sp|Q63HK3|ZKSC2_HUMAN Zinc finger protein with KRAB and SCAN domains 2 OS=Homo sapiens GN=ZKSCAN2 PE=1 SV=2 472 591 4.0E-09
sp|C9JN71|ZN878_HUMAN Zinc finger protein 878 OS=Homo sapiens GN=ZNF878 PE=3 SV=2 514 587 4.0E-09
sp|Q96MU6|ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens GN=ZNF778 PE=1 SV=3 514 648 5.0E-09
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 558 648 5.0E-09
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 468 591 5.0E-09
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 556 646 5.0E-09
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 568 650 5.0E-09
sp|Q8TF68|ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens GN=ZNF384 PE=1 SV=2 531 646 5.0E-09
sp|Q9EQJ4|ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus GN=Znf384 PE=1 SV=1 531 646 5.0E-09
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 523 646 5.0E-09
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 468 589 6.0E-09
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 541 652 6.0E-09
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 524 645 6.0E-09
sp|Q6P5C7|ZN728_MOUSE Zinc finger protein 728 OS=Mus musculus GN=Znf728 PE=2 SV=1 436 590 6.0E-09
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 511 671 6.0E-09
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 514 590 7.0E-09
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 447 646 7.0E-09
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 270 587 7.0E-09
sp|Q9BY31|ZN717_HUMAN Zinc finger protein 717 OS=Homo sapiens GN=ZNF717 PE=2 SV=2 468 606 7.0E-09
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 537 671 7.0E-09
sp|Q0VCB0|ZN350_BOVIN Zinc finger protein 350 OS=Bos taurus GN=ZNF350 PE=2 SV=1 472 589 7.0E-09
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 490 587 8.0E-09
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 556 650 8.0E-09
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 560 648 8.0E-09
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 468 585 9.0E-09
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 470 590 9.0E-09
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 472 586 1.0E-08
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 472 589 1.0E-08
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 472 592 1.0E-08
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 514 587 1.0E-08
sp|Q96MR9|ZN560_HUMAN Zinc finger protein 560 OS=Homo sapiens GN=ZNF560 PE=2 SV=2 514 650 1.0E-08
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 568 648 2.0E-08
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 514 587 2.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 472 613 2.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 472 613 2.0E-08
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 488 586 2.0E-08
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 468 589 2.0E-08
sp|Q96NJ3|ZN285_HUMAN Zinc finger protein 285 OS=Homo sapiens GN=ZNF285 PE=2 SV=2 468 586 2.0E-08
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 514 671 2.0E-08
sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 514 641 2.0E-08
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 516 671 3.0E-08
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 514 688 3.0E-08
sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 514 648 3.0E-08
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 557 648 3.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 472 589 3.0E-08
sp|Q6P280|ZN529_HUMAN Zinc finger protein 529 OS=Homo sapiens GN=ZNF529 PE=2 SV=2 514 592 3.0E-08
sp|A3KN32|ZNF34_BOVIN Zinc finger protein 34 OS=Bos taurus GN=ZNF34 PE=2 SV=1 468 585 3.0E-08
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 472 589 3.0E-08
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 514 588 3.0E-08
sp|Q5TEC3|ZN697_HUMAN Zinc finger protein 697 OS=Homo sapiens GN=ZNF697 PE=2 SV=2 472 585 3.0E-08
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 472 586 3.0E-08
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 518 586 3.0E-08
sp|A2RRD8|ZN320_HUMAN Zinc finger protein 320 OS=Homo sapiens GN=ZNF320 PE=1 SV=1 514 593 3.0E-08
sp|Q3SYV7|ZN345_BOVIN Zinc finger protein 345 OS=Bos taurus GN=ZNF345 PE=2 SV=1 514 595 4.0E-08
sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 504 646 4.0E-08
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 568 650 4.0E-08
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 472 610 6.0E-08
sp|Q96N22|ZN681_HUMAN Zinc finger protein 681 OS=Homo sapiens GN=ZNF681 PE=2 SV=2 514 589 6.0E-08
sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 548 650 6.0E-08
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 514 589 7.0E-08
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 522 648 7.0E-08
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 535 671 7.0E-08
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 568 650 8.0E-08
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 548 646 9.0E-08
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 552 650 9.0E-08
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 552 650 9.0E-08
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 504 650 9.0E-08
sp|Q9BR84|ZN559_HUMAN Zinc finger protein 559 OS=Homo sapiens GN=ZNF559 PE=1 SV=1 525 650 1.0E-07
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 568 665 1.0E-07
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 568 646 1.0E-07
sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 531 650 1.0E-07
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 558 650 1.0E-07
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 514 642 1.0E-07
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 549 646 1.0E-07
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 556 650 1.0E-07
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 538 648 1.0E-07
sp|Q8TA94|ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens GN=ZNF563 PE=2 SV=1 539 648 1.0E-07
sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 514 606 2.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 554 673 2.0E-07
sp|O14628|ZN195_HUMAN Zinc finger protein 195 OS=Homo sapiens GN=ZNF195 PE=1 SV=2 514 643 2.0E-07
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 568 650 2.0E-07
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 520 671 2.0E-07
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 470 589 2.0E-07
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 472 594 2.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 525 648 2.0E-07
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 556 643 2.0E-07
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 546 648 3.0E-07
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 468 685 3.0E-07
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 517 634 3.0E-07
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 523 639 3.0E-07
sp|P51507|ZNF80_PONPY Zinc finger protein 80 OS=Pongo pygmaeus GN=ZNF80 PE=3 SV=1 546 648 3.0E-07
sp|Q8N8Z8|ZN441_HUMAN Zinc finger protein 441 OS=Homo sapiens GN=ZNF441 PE=2 SV=2 468 585 3.0E-07
sp|Q569E7|ZN697_MOUSE Zinc finger protein 697 OS=Mus musculus GN=Znf697 PE=2 SV=1 472 585 3.0E-07
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 514 589 3.0E-07
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 468 618 4.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 547 671 4.0E-07
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 526 665 5.0E-07
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 514 588 6.0E-07
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 531 650 6.0E-07
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 564 673 6.0E-07
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 470 595 7.0E-07
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 564 648 9.0E-07
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 564 648 1.0E-06
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 535 638 1.0E-06
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 468 630 1.0E-06
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 572 650 1.0E-06
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 564 673 1.0E-06
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 556 662 1.0E-06
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 538 650 1.0E-06
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 514 671 2.0E-06
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 548 671 2.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 514 671 2.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 511 673 2.0E-06
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 514 587 2.0E-06
sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 504 651 2.0E-06
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 519 650 2.0E-06
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 514 585 2.0E-06
sp|Q6ZMV8|ZN730_HUMAN Putative zinc finger protein 730 OS=Homo sapiens GN=ZNF730 PE=2 SV=1 531 671 2.0E-06
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 506 648 3.0E-06
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 531 650 3.0E-06
sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=1 SV=1 507 558 3.0E-06
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 560 645 4.0E-06
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 573 650 4.0E-06
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 499 671 4.0E-06
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 549 646 4.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 514 589 4.0E-06
sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=1 SV=3 507 592 5.0E-06
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 470 591 5.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 564 646 5.0E-06
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 557 648 6.0E-06
sp|Q96NL3|ZN599_HUMAN Zinc finger protein 599 OS=Homo sapiens GN=ZNF599 PE=1 SV=1 560 648 7.0E-06
sp|Q8TA94|ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens GN=ZNF563 PE=2 SV=1 538 664 7.0E-06
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 514 628 7.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 514 651 8.0E-06
sp|Q8IZ26|ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens GN=ZNF34 PE=1 SV=3 531 639 8.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 515 627 8.0E-06
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 538 646 8.0E-06
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 553 648 9.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 518 637 9.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 524 671 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|421
MDASHVAYQGHSDVHGPSAADIANISLDFDAMMASDGALSQSLGPFEPCIHDESCLDHHQHLWQPRSGDKLQANF
TQQLHPAGSLSMVRGQDQAHHHQDPSRALTTSPPLQQQHSQASYAWENFLNESALDNSPLPDDFAFGREDDCASE
CSSACEGTCPSQCGDTDHVVCCDDDTCGTPQLCLDEACQGAGRPCMDESCLSETATPDKHTPPGHAVTDRDKAAA
AALASFGDNQLQMIQADFVHPPAPPPSAFRDAPMCFVDLPASLPCVSLSTESLLSNGSPSFPNQPLQMAFEYALA
NHIMQYHDPSHGLAHSGSCIANDPSQFISRCTLPKFHPTDDNADPYLPQLQSHECGFPVQDPNAFAHHIFQEHRP
ALMVHAQQSRLPAAPHAGAHAAVNAPHQPAPRLDCPSLSTTPSSLATPSPFESDAGLAEFAPSRTPQSPAHAPKP
QVLAQEDQFLCRWMVDDEANICGRRFDNDEQLQRHCKFDHLKQLKKARVGFRCGWANCTRNTCFTQRSKLERHMQ
VHTGYKPVHCDICGAALSAKQALDQHMRIHTGETPWVCKFPGCGCAFKQQSALTMHERTHTGDKPLECEICHKRF
SESSNLSKHRRTHNVKGMHECQLCGKDFHRLDQLRRHMGTNHKDRPAEVDALLNKAKPKFQAQRVSKPAKPGVRG
RARPGLDPFDVDTLELIEDQLQGVIIDREP*
Coding >Hirsu2|421
ATGGACGCATCACACGTGGCCTATCAAGGCCATTCGGACGTACACGGCCCGTCCGCCGCCGATATCGCAAACATT
TCGCTCGATTTCGACGCCATGATGGCTTCCGATGGCGCCCTGTCGCAGAGCCTCGGGCCATTCGAACCCTGCATC
CACGACGAATCATGTCTCGACCACCATCAACACCTCTGGCAGCCCAGGTCCGGTGACAAACTACAAGCCAACTTC
ACCCAGCAGCTGCATCCCGCCGGCTCCCTCAGCATGGTGCGCGGCCAGGATCAAGCACACCATCACCAGGACCCG
TCCAGAGCCCTCACGACTTCGCCTCCCCTGCAGCAGCAGCATTCTCAGGCATCGTACGCCTGGGAAAATTTCCTC
AACGAGTCCGCCCTGGACAACTCGCCTCTGCCCGACGATTTCGCCTTCGGCCGAGAAGACGACTGCGCATCCGAA
TGTAGTTCTGCCTGCGAAGGCACATGCCCCAGCCAATGTGGCGACACGGACCATGTCGTCTGCTGCGACGACGAT
ACCTGCGGCACTCCGCAGCTGTGTCTCGATGAAGCTTGTCAAGGCGCAGGCCGGCCTTGCATGGACGAGAGCTGC
CTGTCCGAAACGGCGACACCCGACAAGCACACTCCCCCCGGCCACGCCGTGACGGACCGCGACAAGGCCGCCGCC
GCCGCCCTGGCTTCCTTTGGCGACAATCAGCTGCAGATGATCCAGGCAGACTTCGTCCACCCTCCGGCCCCGCCT
CCCTCCGCATTCCGCGACGCGCCCATGTGCTTCGTCGATCTTCCCGCGAGCCTGCCGTGCGTCAGCCTCTCGACC
GAGTCCTTGCTGTCCAATGGCTCGCCCAGCTTTCCCAACCAGCCCTTGCAGATGGCCTTTGAATACGCCCTGGCA
AACCACATCATGCAGTATCATGACCCCTCGCACGGTCTGGCACATAGCGGAAGCTGCATCGCCAACGATCCGAGC
CAGTTCATTTCAAGATGCACCCTGCCCAAGTTTCACCCCACCGACGACAATGCCGACCCCTATCTGCCCCAGCTT
CAGAGCCACGAATGCGGATTCCCGGTGCAGGACCCCAATGCCTTCGCCCACCACATCTTCCAGGAGCACAGGCCT
GCCCTCATGGTTCACGCCCAGCAAAGCAGGCTTCCAGCCGCCCCCCATGCCGGAGCGCATGCCGCCGTCAACGCA
CCCCATCAGCCCGCACCACGTTTGGATTGCCCTTCTCTCTCGACTACACCATCCTCCCTCGCCACGCCCTCGCCG
TTTGAGTCCGACGCCGGCCTCGCGGAATTCGCCCCCTCCAGGACACCCCAGAGCCCGGCTCATGCGCCCAAGCCC
CAGGTCCTGGCACAGGAAGACCAGTTTCTCTGCCGCTGGATGGTCGACGACGAAGCCAACATTTGCGGCAGGCGC
TTCGATAACGACGAGCAGCTGCAGAGACATTGCAAGTTCGACCACCTGAAGCAGCTCAAGAAGGCCCGCGTGGGC
TTTAGGTGCGGATGGGCAAACTGTACAAGGAACACGTGCTTCACCCAGCGGAGCAAGCTGGAGCGGCACATGCAA
GTCCACACGGGGTACAAGCCGGTTCACTGCGACATATGCGGCGCCGCCCTGTCCGCGAAGCAAGCCCTCGATCAG
CACATGAGGATTCACACGGGCGAGACACCGTGGGTCTGCAAGTTCCCGGGATGCGGATGTGCGTTCAAACAGCAG
AGTGCCCTGACCATGCACGAGCGGACTCACACCGGTGACAAGCCGTTGGAGTGCGAGATATGCCACAAGAGGTTC
AGCGAGTCGTCCAACTTGTCGAAGCACCGAAGGACGCACAACGTCAAGGGCATGCACGAATGCCAGCTCTGCGGC
AAGGACTTCCACAGGCTCGATCAGCTCCGGAGACACATGGGCACAAACCACAAAGACCGGCCTGCCGAGGTAGAC
GCCCTGCTCAACAAGGCCAAGCCCAAGTTCCAGGCTCAAAGGGTGTCGAAGCCGGCGAAGCCCGGGGTCAGGGGC
AGGGCCAGGCCGGGCCTGGACCCCTTTGACGTCGACACACTGGAATTGATTGAGGACCAGCTCCAGGGAGTCATA
ATCGACCGAGAGCCTTGA
Transcript >Hirsu2|421
ATGGACGCATCACACGTGGCCTATCAAGGCCATTCGGACGTACACGGCCCGTCCGCCGCCGATATCGCAAACATT
TCGCTCGATTTCGACGCCATGATGGCTTCCGATGGCGCCCTGTCGCAGAGCCTCGGGCCATTCGAACCCTGCATC
CACGACGAATCATGTCTCGACCACCATCAACACCTCTGGCAGCCCAGGTCCGGTGACAAACTACAAGCCAACTTC
ACCCAGCAGCTGCATCCCGCCGGCTCCCTCAGCATGGTGCGCGGCCAGGATCAAGCACACCATCACCAGGACCCG
TCCAGAGCCCTCACGACTTCGCCTCCCCTGCAGCAGCAGCATTCTCAGGCATCGTACGCCTGGGAAAATTTCCTC
AACGAGTCCGCCCTGGACAACTCGCCTCTGCCCGACGATTTCGCCTTCGGCCGAGAAGACGACTGCGCATCCGAA
TGTAGTTCTGCCTGCGAAGGCACATGCCCCAGCCAATGTGGCGACACGGACCATGTCGTCTGCTGCGACGACGAT
ACCTGCGGCACTCCGCAGCTGTGTCTCGATGAAGCTTGTCAAGGCGCAGGCCGGCCTTGCATGGACGAGAGCTGC
CTGTCCGAAACGGCGACACCCGACAAGCACACTCCCCCCGGCCACGCCGTGACGGACCGCGACAAGGCCGCCGCC
GCCGCCCTGGCTTCCTTTGGCGACAATCAGCTGCAGATGATCCAGGCAGACTTCGTCCACCCTCCGGCCCCGCCT
CCCTCCGCATTCCGCGACGCGCCCATGTGCTTCGTCGATCTTCCCGCGAGCCTGCCGTGCGTCAGCCTCTCGACC
GAGTCCTTGCTGTCCAATGGCTCGCCCAGCTTTCCCAACCAGCCCTTGCAGATGGCCTTTGAATACGCCCTGGCA
AACCACATCATGCAGTATCATGACCCCTCGCACGGTCTGGCACATAGCGGAAGCTGCATCGCCAACGATCCGAGC
CAGTTCATTTCAAGATGCACCCTGCCCAAGTTTCACCCCACCGACGACAATGCCGACCCCTATCTGCCCCAGCTT
CAGAGCCACGAATGCGGATTCCCGGTGCAGGACCCCAATGCCTTCGCCCACCACATCTTCCAGGAGCACAGGCCT
GCCCTCATGGTTCACGCCCAGCAAAGCAGGCTTCCAGCCGCCCCCCATGCCGGAGCGCATGCCGCCGTCAACGCA
CCCCATCAGCCCGCACCACGTTTGGATTGCCCTTCTCTCTCGACTACACCATCCTCCCTCGCCACGCCCTCGCCG
TTTGAGTCCGACGCCGGCCTCGCGGAATTCGCCCCCTCCAGGACACCCCAGAGCCCGGCTCATGCGCCCAAGCCC
CAGGTCCTGGCACAGGAAGACCAGTTTCTCTGCCGCTGGATGGTCGACGACGAAGCCAACATTTGCGGCAGGCGC
TTCGATAACGACGAGCAGCTGCAGAGACATTGCAAGTTCGACCACCTGAAGCAGCTCAAGAAGGCCCGCGTGGGC
TTTAGGTGCGGATGGGCAAACTGTACAAGGAACACGTGCTTCACCCAGCGGAGCAAGCTGGAGCGGCACATGCAA
GTCCACACGGGGTACAAGCCGGTTCACTGCGACATATGCGGCGCCGCCCTGTCCGCGAAGCAAGCCCTCGATCAG
CACATGAGGATTCACACGGGCGAGACACCGTGGGTCTGCAAGTTCCCGGGATGCGGATGTGCGTTCAAACAGCAG
AGTGCCCTGACCATGCACGAGCGGACTCACACCGGTGACAAGCCGTTGGAGTGCGAGATATGCCACAAGAGGTTC
AGCGAGTCGTCCAACTTGTCGAAGCACCGAAGGACGCACAACGTCAAGGGCATGCACGAATGCCAGCTCTGCGGC
AAGGACTTCCACAGGCTCGATCAGCTCCGGAGACACATGGGCACAAACCACAAAGACCGGCCTGCCGAGGTAGAC
GCCCTGCTCAACAAGGCCAAGCCCAAGTTCCAGGCTCAAAGGGTGTCGAAGCCGGCGAAGCCCGGGGTCAGGGGC
AGGGCCAGGCCGGGCCTGGACCCCTTTGACGTCGACACACTGGAATTGATTGAGGACCAGCTCCAGGGAGTCATA
ATCGACCGAGAGCCTTGA
Gene >Hirsu2|421
ATGGACGCATCACACGTGGCCTATCAAGGCCATTCGGACGTACACGGCCCGTCCGCCGCCGATATCGCAAACATT
TCGCTCGATTTCGACGCCATGATGGCTTCCGATGGCGCCCTGTCGCAGAGCCTCGGGCCATTCGAACCCTGCATC
CACGACGAATCATGTCTCGACCACCATCAACACCTCTGGCAGCCCAGGTCCGGTGACAAACTACAAGCCAACTTC
ACCCAGCAGCTGCATCCCGCCGGCTCCCTCAGCATGGTGCGCGGCCAGGATCAAGCACACCATCACCAGGACCCG
TCCAGAGCCCTCACGACTTCGCCTCCCCTGCAGCAGCAGCATTCTCAGGCATCGTACGCCTGGGAAAATTTCCTC
AACGAGTCCGCCCTGGACAACTCGCCTCTGCCCGACGATTTCGCCTTCGGCCGAGAAGACGACTGCGCATCCGAA
TGTAGTTCTGCCTGCGAAGGCACATGCCCCAGCCAATGTGGCGACACGGACCATGTCGTCTGCTGCGACGACGAT
ACCTGCGGCACTCCGCAGCTGTGTCTCGATGAAGCTTGTCAAGGCGCAGGCCGGCCTTGCATGGACGAGAGCTGC
CTGTCCGAAACGGCGACACCCGACAAGCACACTCCCCCCGGCCACGCCGTGACGGACCGCGACAAGGCCGCCGCC
GCCGCCCTGGCTTCCTTTGGCGACAATCAGCTGCAGATGATCCAGGCAGACTTCGTCCACCCTCCGGCCCCGCCT
CCCTCCGCATTCCGCGACGCGCCCATGTGCTTCGTCGATCTTCCCGCGAGCCTGCCGTGCGTCAGCCTCTCGACC
GAGTCCTTGCTGTCCAATGGCTCGCCCAGCTTTCCCAACCAGCCCTTGCAGATGGCCTTTGAATACGCCCTGGCA
AACCACATCATGCAGTATCATGACCCCTCGCACGGTCTGGCACATAGCGGAAGCTGCATCGCCAACGATCCGAGC
CAGTTCATTTCAAGATGCACCCTGCCCAAGTTTCACCCCACCGACGACAATGCCGACCCCTATCTGCCCCAGCTT
CAGAGCCACGAATGCGGATTCCCGGTGCAGGACCCCAATGCCTTCGCCCACCACATCTTCCAGGAGCACAGGCCT
GCCCTCATGGTTCACGCCCAGCAAAGCAGGCTTCCAGCCGCCCCCCATGCCGGAGCGCATGCCGCCGTCAACGCA
CCCCATCAGCCCGCACCACGTTTGGATTGTCAGAACACGGCTCACGCGACGCATGGCCAGCAGTTCTCCCCGTCT
CCGTCGCCTTTGACAACGGTATCAGTAGGCCCTTCTCTCTCGACTACACCATCCTCCCTCGCCACGCCCTCGCCG
TTTGAGTCCGACGCCGGCCTCGCGGAATTCGCCCCCTCCAGGACACCCCAGAGCCCGGCTCATGCGCCCAAGCCC
CAGGTCCTGGCACAGGAAGACCAGTTTCTCTGCCGCTGGATGGTCGACGACGAAGCCAACATTTGCGGCAGGCGC
TTCGATAACGACGAGCAGCTGCAGAGACATTGCAAGTTCGACCACCTGAAGCAGCTCAAGAAGGCCCGCGTGGGC
TTTAGGTGCGGATGGGCAAACTGTACAAGGAACACGTGCTTCACCCAGCGGAGCAAGCTGGAGCGGCACATGCAA
GTCCACACGGGGTGTAAGCCGCACACCACGACCGACCGCCTCGCCGAATCGAAGCTAACCCAGACTCAGACAAGC
CGGTTCACTGCGACATATGCGGCGCCGCCCTGTCCGCGAAGCAAGCCCTCGATCAGCACATGAGGATTCACACGG
GCGAGACACCGTGGGTCTGCAAGTTCCCGGGATGCGGATGTGCGTTCAAACAGCAGAGTGCCCTGAGTGAGTCTC
GTCCTGCCGCTCCGTCGGGAAGCGCCGTCGTCGCTAACCTCGGCACAGCCATGCACGAGCGGACTCACACCGGTG
ACAAGCCGTTGGAGTGCGAGATATGCCACAAGAGGTTCAGCGAGTCGTCCAACTTGTCGAAGCACCGAAGGACGC
ACAACGTCAAGGGCATGCACGAATGCCAGCTCTGCGGCAAGGACTTCCACAGGCTCGATCAGCTCCGGAGACACA
TGGGCACAAACCACAAAGACCGGCCTGCCGAGGTAGACGCCCTGCTCAACAAGGCCAAGCCCAAGTTCCAGGCTC
AAAGGGTGTCGAAGCCGGCGAAGCCCGGGGTCAGGGGCAGGGCCAGGCCGGGCCTGGACCCCTTTGACGTCGACA
CACTGGAATTGATTGAGGACCAGCTCCAGGGAGTCATAATCGACCGAGAGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail