Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4206
Gene name
LocationContig_2168:42..2698
Strand-
Gene length (bp)2656
Transcript length (bp)2307
Coding sequence length (bp)2307
Protein length (aa) 769

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03200 Glyco_hydro_63 Glycosyl hydrolase family 63 C-terminal domain 9.8E-146 303 768
PF16923 Glyco_hydro_63N Glycosyl hydrolase family 63 N-terminal domain 4.5E-79 38 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14255|GCS1_SCHPO Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.09 PE=3 SV=1 30 768 0.0E+00
sp|P53008|CWH41_YEAST Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH41 PE=1 SV=1 2 768 6.0E-165
sp|Q80UM7|MOGS_MOUSE Mannosyl-oligosaccharide glucosidase OS=Mus musculus GN=Mogs PE=1 SV=1 39 768 7.0E-115
sp|Q13724|MOGS_HUMAN Mannosyl-oligosaccharide glucosidase OS=Homo sapiens GN=MOGS PE=1 SV=5 39 768 2.0E-110
sp|O88941|MOGS_RAT Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus GN=Mogs PE=1 SV=1 39 768 2.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14255|GCS1_SCHPO Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.09 PE=3 SV=1 30 768 0.0E+00
sp|P53008|CWH41_YEAST Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH41 PE=1 SV=1 2 768 6.0E-165
sp|Q80UM7|MOGS_MOUSE Mannosyl-oligosaccharide glucosidase OS=Mus musculus GN=Mogs PE=1 SV=1 39 768 7.0E-115
sp|Q13724|MOGS_HUMAN Mannosyl-oligosaccharide glucosidase OS=Homo sapiens GN=MOGS PE=1 SV=5 39 768 2.0E-110
sp|O88941|MOGS_RAT Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus GN=Mogs PE=1 SV=1 39 768 2.0E-107
sp|F4HTM3|GCS1_ARATH Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana GN=GCS1 PE=1 SV=1 35 768 3.0E-105
sp|Q84M89|GCS2_ARATH Alpha-glucosidase 2 OS=Arabidopsis thaliana GN=GCS2 PE=2 SV=1 37 768 2.0E-99
sp|Q19426|MOGS1_CAEEL Mannosyl-oligosaccharide glucosidase OS=Caenorhabditis elegans GN=mogs-1 PE=1 SV=2 36 768 3.0E-89
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4206
MAKLARLLAAAASLAVGASAAGGEPSLTGEADRLNNQSLLWGPYKPNLYFGVRPRVPKGLWTGLMWGRMEQYEDV
KDGFRYTCEQGPDMHGYGWDEYDARTGGVQSIHDEGNNIDLTTSFVKVPGGQHGGSWAARIRGRPRGDAPETLKT
TVYYYIAQEGEGDLEAVVEDGAEAGLDGDATFRGWSAPLGNYSLVVTKGDGRHPTSDHEISAARPADKTVVFSQD
ADEELLWQAKALLFQQLQKTSAQVQETYDAEDLPPPWQVYRIGHRPGRGNVHMVQKTFEGPFEFDVIFSSGSAGK
RLTSAEVTQAIRRTSESFGRRFSRVFELQAPFRADKYQAFAKSMFSNLLGGVGYFHGEQLVDRSYAPEYDEDGEG
FWAEAAEARARGAQKLEGPYELLTSVPSRPFFPRGFLWDEGFHLMAIADWDLDLALEMVESWFGAMDEDGWIPRE
QILGAEARSKVPEEFQVQYPHYANPPTLFLVVEAFVERLARVKSGRDKESGSDRSGPYAAHLERGGALGEEYLRR
LYPLLRRQYDWFRRTQRGEVRAYEREAYSSREAYRWRGRTETHCLTSGLDDYPRPQPPHPGELHVDLLSWVGLMT
RSLMRTASALGMAEEASELGERLEAVERNLADLHWSEREGCYCDATIDEFEEHRLVCHKGYVSLFPLLAGLLRPD
EPRLGRLLELMGDERQVWSAHGLRSLSRADELYGTGENYWRSPVWMPLNYMAVTQLHSIATTNGPFQAKARELYG
RLRRNLVETVYKSWAETG*
Coding >Hirsu2|4206
ATGGCCAAACTCGCACGACTCCTTGCGGCGGCCGCGTCGCTAGCGGTCGGCGCCTCGGCTGCGGGCGGCGAGCCG
AGCCTGACGGGCGAGGCCGACCGCCTCAACAACCAGAGCCTGCTGTGGGGGCCGTACAAGCCCAATCTGTATTTC
GGCGTCCGGCCCAGGGTGCCCAAGGGCCTCTGGACCGGCCTCATGTGGGGGAGGATGGAGCAGTACGAGGACGTC
AAGGACGGATTTCGATACACGTGTGAGCAGGGCCCGGACATGCACGGCTACGGCTGGGACGAGTACGACGCGCGA
ACCGGCGGCGTGCAGTCGATCCACGACGAGGGCAACAACATCGACCTCACCACCTCGTTCGTCAAGGTGCCGGGC
GGACAGCACGGGGGCAGCTGGGCCGCCAGGATCCGCGGGCGGCCGCGGGGTGACGCGCCGGAGACGCTGAAAACG
ACTGTCTACTACTACATCGCGCAGGAGGGCGAGGGGGACCTCGAGGCCGTGGTCGAGGACGGCGCCGAGGCGGGT
CTCGACGGCGACGCCACCTTCCGCGGCTGGTCGGCGCCGCTGGGCAACTACAGCCTGGTGGTGACCAAGGGAGAC
GGGCGGCATCCTACGAGCGATCACGAGATATCGGCCGCGCGGCCGGCGGACAAGACGGTCGTCTTCAGCCAGGAC
GCGGACGAGGAACTGCTGTGGCAGGCCAAGGCGCTCCTCTTCCAGCAGCTCCAGAAGACGTCGGCGCAGGTGCAG
GAGACGTACGACGCCGAGGACCTGCCGCCGCCGTGGCAGGTCTACCGCATCGGCCATCGGCCCGGCAGGGGCAAC
GTGCACATGGTGCAGAAGACGTTCGAGGGCCCCTTCGAGTTCGACGTCATCTTCTCGTCGGGCTCGGCGGGCAAG
CGGCTGACGTCGGCCGAAGTGACGCAGGCGATCCGGCGGACGTCGGAATCGTTCGGCCGGCGCTTCTCGCGCGTC
TTCGAGCTGCAGGCGCCCTTCCGGGCGGACAAGTACCAGGCCTTCGCCAAGAGCATGTTCTCGAACCTGCTCGGC
GGCGTCGGCTACTTCCACGGCGAGCAGCTGGTGGACCGGTCCTACGCGCCCGAGTACGACGAGGACGGCGAGGGC
TTCTGGGCCGAGGCGGCGGAGGCGCGGGCGCGGGGCGCGCAGAAGCTCGAGGGGCCGTACGAGCTCCTGACGAGC
GTCCCGTCGCGGCCCTTCTTCCCGCGCGGCTTCCTGTGGGACGAGGGCTTCCACCTGATGGCGATTGCCGACTGG
GACCTGGACCTGGCGCTCGAGATGGTCGAGAGCTGGTTCGGCGCCATGGACGAGGACGGGTGGATCCCGCGCGAG
CAGATCCTGGGGGCCGAGGCGCGCAGCAAGGTGCCGGAGGAGTTCCAGGTGCAGTACCCGCACTACGCCAACCCG
CCGACGCTGTTCCTCGTCGTCGAGGCCTTTGTCGAGCGGCTCGCCAGGGTCAAGTCGGGGCGGGACAAGGAGTCG
GGGTCGGACAGGTCGGGCCCCTACGCGGCGCACCTGGAGCGGGGGGGCGCCCTCGGGGAGGAGTACCTGCGCCGG
CTGTACCCGCTGCTCCGGCGGCAGTACGACTGGTTCCGGCGGACGCAGCGGGGCGAGGTGCGGGCGTACGAGCGC
GAGGCGTACTCGAGCCGGGAGGCGTACCGGTGGCGCGGGCGGACGGAGACGCACTGCCTGACGAGCGGGCTGGAC
GACTACCCGCGACCGCAGCCGCCGCACCCGGGGGAGCTGCACGTGGACCTGCTGTCGTGGGTCGGGCTGATGACG
CGGTCGCTGATGCGGACGGCGTCGGCGCTCGGCATGGCCGAGGAGGCGTCGGAGCTGGGGGAGAGGCTCGAGGCG
GTGGAGCGCAACCTGGCGGACCTGCACTGGTCGGAGCGGGAGGGGTGCTACTGCGACGCGACGATTGACGAGTTC
GAGGAGCACCGGCTGGTCTGCCACAAGGGCTATGTGTCGCTGTTCCCGCTGCTGGCCGGGCTGCTGCGGCCGGAC
GAGCCGAGGCTGGGCCGGCTGCTGGAGCTGATGGGCGACGAGCGGCAGGTGTGGAGCGCGCATGGGCTGCGCAGC
CTGAGTCGAGCGGACGAGCTGTACGGGACGGGAGAGAACTATTGGAGGAGCCCGGTGTGGATGCCTCTCAACTAC
ATGGCCGTGACGCAGCTTCACAGCATCGCCACGACAAACGGGCCTTTTCAGGCCAAGGCGCGGGAGCTGTACGGG
CGGCTGCGGCGCAACCTGGTCGAGACGGTTTACAAGAGTTGGGCCGAGACGGGTTGA
Transcript >Hirsu2|4206
ATGGCCAAACTCGCACGACTCCTTGCGGCGGCCGCGTCGCTAGCGGTCGGCGCCTCGGCTGCGGGCGGCGAGCCG
AGCCTGACGGGCGAGGCCGACCGCCTCAACAACCAGAGCCTGCTGTGGGGGCCGTACAAGCCCAATCTGTATTTC
GGCGTCCGGCCCAGGGTGCCCAAGGGCCTCTGGACCGGCCTCATGTGGGGGAGGATGGAGCAGTACGAGGACGTC
AAGGACGGATTTCGATACACGTGTGAGCAGGGCCCGGACATGCACGGCTACGGCTGGGACGAGTACGACGCGCGA
ACCGGCGGCGTGCAGTCGATCCACGACGAGGGCAACAACATCGACCTCACCACCTCGTTCGTCAAGGTGCCGGGC
GGACAGCACGGGGGCAGCTGGGCCGCCAGGATCCGCGGGCGGCCGCGGGGTGACGCGCCGGAGACGCTGAAAACG
ACTGTCTACTACTACATCGCGCAGGAGGGCGAGGGGGACCTCGAGGCCGTGGTCGAGGACGGCGCCGAGGCGGGT
CTCGACGGCGACGCCACCTTCCGCGGCTGGTCGGCGCCGCTGGGCAACTACAGCCTGGTGGTGACCAAGGGAGAC
GGGCGGCATCCTACGAGCGATCACGAGATATCGGCCGCGCGGCCGGCGGACAAGACGGTCGTCTTCAGCCAGGAC
GCGGACGAGGAACTGCTGTGGCAGGCCAAGGCGCTCCTCTTCCAGCAGCTCCAGAAGACGTCGGCGCAGGTGCAG
GAGACGTACGACGCCGAGGACCTGCCGCCGCCGTGGCAGGTCTACCGCATCGGCCATCGGCCCGGCAGGGGCAAC
GTGCACATGGTGCAGAAGACGTTCGAGGGCCCCTTCGAGTTCGACGTCATCTTCTCGTCGGGCTCGGCGGGCAAG
CGGCTGACGTCGGCCGAAGTGACGCAGGCGATCCGGCGGACGTCGGAATCGTTCGGCCGGCGCTTCTCGCGCGTC
TTCGAGCTGCAGGCGCCCTTCCGGGCGGACAAGTACCAGGCCTTCGCCAAGAGCATGTTCTCGAACCTGCTCGGC
GGCGTCGGCTACTTCCACGGCGAGCAGCTGGTGGACCGGTCCTACGCGCCCGAGTACGACGAGGACGGCGAGGGC
TTCTGGGCCGAGGCGGCGGAGGCGCGGGCGCGGGGCGCGCAGAAGCTCGAGGGGCCGTACGAGCTCCTGACGAGC
GTCCCGTCGCGGCCCTTCTTCCCGCGCGGCTTCCTGTGGGACGAGGGCTTCCACCTGATGGCGATTGCCGACTGG
GACCTGGACCTGGCGCTCGAGATGGTCGAGAGCTGGTTCGGCGCCATGGACGAGGACGGGTGGATCCCGCGCGAG
CAGATCCTGGGGGCCGAGGCGCGCAGCAAGGTGCCGGAGGAGTTCCAGGTGCAGTACCCGCACTACGCCAACCCG
CCGACGCTGTTCCTCGTCGTCGAGGCCTTTGTCGAGCGGCTCGCCAGGGTCAAGTCGGGGCGGGACAAGGAGTCG
GGGTCGGACAGGTCGGGCCCCTACGCGGCGCACCTGGAGCGGGGGGGCGCCCTCGGGGAGGAGTACCTGCGCCGG
CTGTACCCGCTGCTCCGGCGGCAGTACGACTGGTTCCGGCGGACGCAGCGGGGCGAGGTGCGGGCGTACGAGCGC
GAGGCGTACTCGAGCCGGGAGGCGTACCGGTGGCGCGGGCGGACGGAGACGCACTGCCTGACGAGCGGGCTGGAC
GACTACCCGCGACCGCAGCCGCCGCACCCGGGGGAGCTGCACGTGGACCTGCTGTCGTGGGTCGGGCTGATGACG
CGGTCGCTGATGCGGACGGCGTCGGCGCTCGGCATGGCCGAGGAGGCGTCGGAGCTGGGGGAGAGGCTCGAGGCG
GTGGAGCGCAACCTGGCGGACCTGCACTGGTCGGAGCGGGAGGGGTGCTACTGCGACGCGACGATTGACGAGTTC
GAGGAGCACCGGCTGGTCTGCCACAAGGGCTATGTGTCGCTGTTCCCGCTGCTGGCCGGGCTGCTGCGGCCGGAC
GAGCCGAGGCTGGGCCGGCTGCTGGAGCTGATGGGCGACGAGCGGCAGGTGTGGAGCGCGCATGGGCTGCGCAGC
CTGAGTCGAGCGGACGAGCTGTACGGGACGGGAGAGAACTATTGGAGGAGCCCGGTGTGGATGCCTCTCAACTAC
ATGGCCGTGACGCAGCTTCACAGCATCGCCACGACAAACGGGCCTTTTCAGGCCAAGGCGCGGGAGCTGTACGGG
CGGCTGCGGCGCAACCTGGTCGAGACGGTTTACAAGAGTTGGGCCGAGACGGGTTGA
Gene >Hirsu2|4206
ATGGCCAAACTCGCACGACTCCTTGCGGCGGCCGCGTCGCTAGCGGTCGGCGCCTCGGCTGCGGGCGGCGAGCCG
AGCCTGACGGGCGAGGCCGACCGCCTCAACAACCAGAGCCTGCTGTGGGGGCCGTACAAGCCCAATCTGTATTTC
GGCGTCCGGCCCAGGGTGCCCAAGGGCCTCTGGACCGGCCTCATGTGGGGGAGGATGGAGCAGTACGAGGACGTC
AAGGACGGTTCGTTCGCCCCTTTTCTGCTGTCCTCTCGTCACCGGCCGGCGGCCCCATCTGATGGGCTCGTGCCT
TTAGGATTTCGATACACGTGTGAGCAGGGCCCGGACATGCACGGCTACGGCTGGGACGAGTACGACGCGCGAACC
GGCGGCGTGCAGTCGATCCACGACGAGGGCAACAACATCGACCTCACCACCTCGTTCGTCAAGGTGCCGGGCGGA
CAGCACGGGGGCAGCTGGGCCGCCAGGATCCGCGGGCGGCCGCGGGGTGACGCGCCGGAGACGCTGAAAACGACT
GTCTACTACTACATCGCGCAGGAGGGCGAGGGGGACCTCGAGGCCGTGGTCGAGGACGGCGCCGAGGCGGGTCTC
GACGGCGACGCCACCTTCCGCGGCTGGTCGGCGCCGCTGGGCAACTACAGCCTGGTGGTGACCAAGGGAGACGGG
CGGCATCCTACGAGCGATCACGAGATATCGGCCGCGCGGCCGGCGGACAAGACGGTCGTCTTCAGCCAGGACGCG
GACGAGGAACTGCTGTGGCAGGCCAAGGCGCTCCTCTTCCAGCAGCTCCAGAAGACGTCGGCGCAGGTGCAGGAG
ACGTACGACGCCGAGGACCTGCCGCCGCCGTGGCAGGTCTACCGCATCGGCCATCGGCCCGGCAGGGGCAACGTG
CACATGGTGCAGAAGACGTTCGAGGGCCCCTTCGAGTTCGACGTCATCTTCTCGTCGGGCTCGGCGGGCAAGCGG
CTGACGTCGGCCGAAGTGACGCAGGCGATCCGGCGGACGTCGGAATCGTTCGGCCGGCGCTTCTCGCGCGTCTTC
GAGCTGCAGGCGCCCTTCCGGGCGGACAAGTACCAGGCCTTCGCCAAGAGCATGTTCTCGAACCTGCTCGGCGGC
GTCGGCTACTTCCACGGCGAGCAGCTGGTGGACCGGTCCTACGCGCCCGAGTACGACGAGGACGGCGAGGGCTTC
TGGGCCGAGGCGGCGGAGGCGCGGGCGCGGGGCGCGCAGAAGCTCGAGGGGCCGTACGAGCTCCTGACGAGCGTC
CCGTCGCGGCCCTTCTTCCCGCGCGGCTTCCTGTGGGACGAGGGCTTCCACCTGATGGCGATTGCCGACTGGGAC
CTGGACCTGGCGCTCGAGATGGTCGAGAGCTGGTTCGGCGCCATGGACGAGGACGGGTGGATCCCGCGCGAGCAG
ATCCTGGGGGCCGAGGCGCGCAGCAAGGTGCCGGAGGAGTTCCAGGTGCAGTACCCGCACTACGCCAACCCGCCG
ACGCTGTTCCTCGTCGTCGAGGCCTTTGTCGAGCGGCTCGCCAGGGTCAAGTCGGGGCGGGACAAGGAGTCGGGG
TCGGACAGGTCGGGCCCCTACGCGGCGCACCTGGAGCGGGGGGGCGCCCTCGGGGAGGAGTACCTGCGCCGGCTG
TACCCGCTGCTCCGGCGGCAGTACGACTGGTTCCGGCGGACGCAGCGGGGCGAGGTGCGGGCGTACGAGCGCGAG
GCGTACTCGAGCCGGGAGGCGTACCGGTGGCGCGGGCGGACGGAGACGCACTGCCTGACGAGCGGGCTGGACGAC
TACCCGCGACCGCAGCCGCCGCACCCGGGGGAGCTGCACGTGGACCTGCTGTCGTGGGTCGGGCTGATGACGCGG
TCGCTGATGCGGACGGCGTCGGCGCTCGGCATGGCCGAGGAGGCGTCGGAGCTGGGGGAGAGGCTCGAGGCGGTG
GAGCGCAACCTGGCGGACCTGCACTGGTCGGAGCGGGAGGGGTGCTACTGCGACGCGACGATTGACGAGTTCGAG
GAGCACCGGCTGGTCTGCCACAAGGGCTATGTGTCGCTGTTCCCGCTGCTGGCCGGGCTGCTGCGGCCGGACGAG
CCGAGGCTGGGCCGGCTGCTGGAGCTGATGGGCGACGAGCGGCAGGTGTGGAGCGCGCATGGGCTGCGCAGCCTG
AGTCGAGCGGACGAGCTGTACGGGACGGGAGAGAACTATTGGAGGAGCCCGGTGTGGATGCCTCTCAACTACATG
GCCGTGACGCAGCTTCACGTAAGGCTGAGTCTCGCCCCCTCCGTCCCCCCCCTTTCCCCCCCCTCGGTTTTTTTT
GTTTTTTTTTTTTTTTTGCTCCCCCTGACTCCCTCACTCCCTCTGTGTCTGTGTCTCTCGGCCCCCTCGACCGAG
TTTGCGGCGCGGACGTTGTTGGCAGGCGGCTAACGGGCTGTTGGGTCCTCGCACCGGCAGAGCATCGCCACGACA
AACGGGCCTTTTCAGGCCAAGGCGCGGGAGCTGTACGGGCGGCTGCGGCGCAACCTGGTCGAGACGGTTTACAAG
AGTTGGGCCGAGACGGGGTTCGCGTGGGAGCAGTACAGCCCCGAGACGGGGGCCGGGCAGCGGACGCAGCACTTT
ACCGGCTGGACCAGCCTGGTGGTCAAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail