Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4198
Gene name
LocationContig_216:25437..26545
Strand-
Gene length (bp)1108
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01553 Acyltransferase Acyltransferase 6.6E-33 100 217

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33333|PLSC_YEAST Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLC1 PE=1 SV=1 34 267 1.0E-62
sp|Q9US20|YLD2_SCHPO Uncharacterized acyltransferase C1851.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1851.02 PE=3 SV=1 37 279 2.0E-56
sp|Q22267|PLC2_CAEEL Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-2 OS=Caenorhabditis elegans GN=acl-2 PE=3 SV=1 67 278 2.0E-37
sp|Q8K3K7|PLCB_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Mus musculus GN=Agpat2 PE=1 SV=1 46 273 2.0E-36
sp|Q95JH0|PLCA_SHEEP 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Ovis aries GN=AGPAT1 PE=2 SV=1 101 278 1.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33333|PLSC_YEAST Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLC1 PE=1 SV=1 34 267 1.0E-62
sp|Q9US20|YLD2_SCHPO Uncharacterized acyltransferase C1851.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1851.02 PE=3 SV=1 37 279 2.0E-56
sp|Q22267|PLC2_CAEEL Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-2 OS=Caenorhabditis elegans GN=acl-2 PE=3 SV=1 67 278 2.0E-37
sp|Q8K3K7|PLCB_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Mus musculus GN=Agpat2 PE=1 SV=1 46 273 2.0E-36
sp|Q95JH0|PLCA_SHEEP 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Ovis aries GN=AGPAT1 PE=2 SV=1 101 278 1.0E-35
sp|O15120|PLCB_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens GN=AGPAT2 PE=1 SV=1 27 273 2.0E-35
sp|Q99943|PLCA_HUMAN 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Homo sapiens GN=AGPAT1 PE=1 SV=2 101 278 4.0E-35
sp|Q95JH2|PLCA_BOVIN 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Bos taurus GN=AGPAT1 PE=2 SV=1 101 278 5.0E-35
sp|Q93841|PLC1_CAEEL Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase acl-1 OS=Caenorhabditis elegans GN=acl-1 PE=3 SV=2 11 265 4.0E-31
sp|O35083|PLCA_MOUSE 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Mus musculus GN=Agpat1 PE=1 SV=1 101 278 3.0E-30
sp|P44848|PLSC_HAEIN 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=plsC PE=3 SV=1 35 276 6.0E-30
sp|P0A257|PLSC_SALTY 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=plsC PE=3 SV=1 103 276 6.0E-26
sp|P0A258|PLSC_SALTI 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Salmonella typhi GN=plsC PE=3 SV=1 103 276 6.0E-26
sp|P26647|PLSC_ECOLI 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) GN=plsC PE=1 SV=1 103 276 2.0E-25
sp|Q42870|PLSC_LIMDO 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Limnanthes douglasii GN=PLSC PE=2 SV=1 79 264 3.0E-21
sp|Q42868|PLSC_LIMAL 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Limnanthes alba PE=2 SV=1 79 264 2.0E-20
sp|Q42670|PLSC_COCNU 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Cocos nucifera PE=1 SV=1 35 255 2.0E-19
sp|Q9LLY4|LPAT1_BRANA 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic OS=Brassica napus GN=LPAT1 PE=2 SV=1 30 244 4.0E-15
sp|Q9ZJN8|PLSC_HELPJ 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=plsC PE=3 SV=1 104 274 5.0E-14
sp|O25903|PLSC_HELPY 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=plsC PE=3 SV=1 104 273 1.0E-13
sp|Q59188|PLSC_BORBU 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=plsC PE=3 SV=2 46 234 1.0E-13
sp|Q8GXU8|LPAT1_ARATH 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=LPAT1 PE=2 SV=1 18 244 1.0E-13
sp|Q59601|PLSC_NEIGO 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Neisseria gonorrhoeae GN=plsC PE=3 SV=1 108 222 3.0E-10
sp|Q9JU41|PLSC_NEIMA 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=plsC PE=3 SV=1 108 222 3.0E-10
sp|Q9JZ47|PLSC_NEIMB 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=plsC PE=3 SV=1 108 222 3.0E-10
sp|P75479|PLSC_MYCPN Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=plsC PE=3 SV=1 79 223 8.0E-10
sp|Q49402|PLSC_MYCGE Probable 1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=plsC PE=3 SV=1 101 271 2.0E-08
sp|Q8L7R3|LPCT1_ARATH Lysophospholipid acyltransferase LPEAT1 OS=Arabidopsis thaliana GN=LPEAT1 PE=1 SV=1 101 217 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016746 transferase activity, transferring acyl groups Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 39 61 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4198
MSAFVNLVCKFLAGYLGLTMALYLASLALPRAGFLARLLAAYMTLVVCAVFNIVAAVVLSLSGHQDISQWLAARS
FHHLMRWTIGVDFVIDDPNKLLATLRPAVFVGNHQTELDVLMLGAMFPKYCSVTAKADLKHMPFLGWFMRLSGTI
FIDRKNAKGAREAMHGAAHEIRSRRQSVYIFPEGTRSYAREPALLPFKKGAFHLAIQAGVPIVPCVVANYSHILY
IKDMVFRSGTVPVKVLDPIPTEGLGPADVDDLARRTYDIMLNEYVALSAKVRGQPMPVPASPSKAATSSAVDTAS
R*
Coding >Hirsu2|4198
ATGTCGGCCTTTGTCAACCTCGTCTGCAAGTTCCTCGCCGGCTACCTGGGCCTCACCATGGCCCTGTACCTGGCC
TCGCTCGCCCTGCCCCGGGCCGGCTTCCTGGCCCGCCTGCTGGCCGCCTACATGACGCTGGTCGTCTGCGCCGTC
TTCAACATCGTCGCCGCCGTCGTCCTCAGCCTCAGCGGCCACCAGGACATCTCGCAGTGGCTCGCCGCCCGCTCC
TTCCACCACCTGATGCGCTGGACCATCGGCGTCGACTTCGTCATCGACGACCCCAACAAGCTCCTCGCCACCCTC
CGCCCCGCCGTCTTCGTCGGCAACCACCAGACGGAGCTCGACGTGCTCATGCTCGGCGCCATGTTCCCCAAGTAC
TGCAGCGTCACCGCCAAGGCCGACCTCAAGCACATGCCCTTCCTCGGCTGGTTCATGCGCCTCAGCGGCACCATC
TTCATCGACCGCAAGAACGCAAAGGGCGCCCGCGAGGCCATGCACGGCGCCGCCCACGAGATCCGCTCCCGCCGC
CAGAGCGTCTACATCTTCCCCGAGGGCACCCGCAGCTACGCCCGCGAGCCCGCCCTGCTGCCCTTCAAGAAGGGC
GCCTTCCACCTCGCCATCCAGGCCGGCGTCCCCATCGTCCCCTGCGTCGTCGCCAACTACAGCCACATCCTCTAC
ATCAAGGACATGGTCTTTCGCTCCGGCACCGTTCCTGTGAAAGTCCTCGACCCCATCCCCACCGAGGGCCTCGGC
CCCGCCGACGTCGACGACCTCGCCCGCCGCACCTACGACATCATGCTCAACGAGTACGTCGCCCTGTCCGCCAAG
GTCCGCGGCCAGCCCATGCCGGTGCCCGCTTCCCCCAGCAAAGCCGCCACCAGCTCGGCCGTCGACACGGCCTCC
CGTTGA
Transcript >Hirsu2|4198
ATGTCGGCCTTTGTCAACCTCGTCTGCAAGTTCCTCGCCGGCTACCTGGGCCTCACCATGGCCCTGTACCTGGCC
TCGCTCGCCCTGCCCCGGGCCGGCTTCCTGGCCCGCCTGCTGGCCGCCTACATGACGCTGGTCGTCTGCGCCGTC
TTCAACATCGTCGCCGCCGTCGTCCTCAGCCTCAGCGGCCACCAGGACATCTCGCAGTGGCTCGCCGCCCGCTCC
TTCCACCACCTGATGCGCTGGACCATCGGCGTCGACTTCGTCATCGACGACCCCAACAAGCTCCTCGCCACCCTC
CGCCCCGCCGTCTTCGTCGGCAACCACCAGACGGAGCTCGACGTGCTCATGCTCGGCGCCATGTTCCCCAAGTAC
TGCAGCGTCACCGCCAAGGCCGACCTCAAGCACATGCCCTTCCTCGGCTGGTTCATGCGCCTCAGCGGCACCATC
TTCATCGACCGCAAGAACGCAAAGGGCGCCCGCGAGGCCATGCACGGCGCCGCCCACGAGATCCGCTCCCGCCGC
CAGAGCGTCTACATCTTCCCCGAGGGCACCCGCAGCTACGCCCGCGAGCCCGCCCTGCTGCCCTTCAAGAAGGGC
GCCTTCCACCTCGCCATCCAGGCCGGCGTCCCCATCGTCCCCTGCGTCGTCGCCAACTACAGCCACATCCTCTAC
ATCAAGGACATGGTCTTTCGCTCCGGCACCGTTCCTGTGAAAGTCCTCGACCCCATCCCCACCGAGGGCCTCGGC
CCCGCCGACGTCGACGACCTCGCCCGCCGCACCTACGACATCATGCTCAACGAGTACGTCGCCCTGTCCGCCAAG
GTCCGCGGCCAGCCCATGCCGGTGCCCGCTTCCCCCAGCAAAGCCGCCACCAGCTCGGCCGTCGACACGGCCTCC
CGTTGA
Gene >Hirsu2|4198
ATGTCGGCCTTTGTCAACCTCGTCTGCAAGTTCCTCGCCGGCTACCTGGGCCTCACCATGGCCCTGTACCTGGCC
TCGCTCGCCCTGCCCCGGGCCGGCTTCCTGGCCCGCCTGCTGGCCGCCTACATGACGCTGGTCGTCTGCGCCGTC
TTCAACATCGTCGCCGCCGTCGTCCTCAGCCTCAGCGGCCACCAGGACATCTCGCAGTGGCTCGCCGCCCGCTCC
TTCCACCACCTGATGCGCTGGACCATCGGCGTCGACTTCGTCATCGACGACCCCAACAAGCTCCTCGCCACCCTC
CGCCCCGCCGTCTTCGTCGGCAACCACCAGACGGAGCTCGACGTGCTCATGCTCGGCGCCATGTTCCCCAAGTAC
TGCAGCGTCACCGCCAAGGCCGACCTCAAGCACATGCCCTTCCTCGGCTGGTTCATGCGCCTCAGCGGCACCATC
TTCATCGACCGCAAGAACGCAAAGGGCGCCCGCGAGGCCATGCACGGCGCCGCCCACGAGATCCGCTCCCGCCGC
CAGAGCGTCTACATCTTCCCCGAGGGCACCCGCAGCTACGCCCGCGAGCCCGCCCTGCTGCCCTTCAAGAAGGGC
GCCTTCCACCTCGCCATCCAGGCCGGCGTCCCCATCGTCCCCTGCGTCGTCGCCAACTACAGCCACATCCTCTAC
ATCAAGGACATGGTCTTTCGCTCCGGCACCGTTCCTGTGAAAGGTAAGTTGCCCCCTTTCACTGTCTCTCTTGCG
CCCCTGGCTGTGGGGAGAGACGGAGACGCAGAGGGATGGAGAGATGGAGAGATGGAGACGGGGAGAGATGGACAG
GTGGACAGATGGAGAGACGGAGACGGGGAGAGACGGACAGACGGACAGACGGAGTATACATGTGCTGACCTTTCC
TCCCCCCCCTGCCTCTCCAGTCCTCGACCCCATCCCCACCGAGGGCCTCGGCCCCGCCGACGTCGACGACCTCGC
CCGCCGCACCTACGACATCATGCTCAACGAGTACGTCGCCCTGTCCGCCAAGGTCCGCGGCCAGCCCATGCCGGT
GCCCGCTTCCCCCAGCAAAGCCGCCACCAGCTCGGCCGTCGACACGGCCTCCCGTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail