Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4194
Gene name
LocationContig_216:12297..13478
Strand-
Gene length (bp)1181
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03820 Mtc Tricarboxylate carrier 1.0E-114 16 353

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13793|FSF1_SCHPO Probable mitochondrial transport protein fsf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fsf1 PE=3 SV=2 10 353 5.0E-118
sp|Q12029|FSF1_YEAST Probable mitochondrial transport protein FSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FSF1 PE=1 SV=1 1 353 1.0E-111
sp|Q54NQ9|SFXN_DICDI Sideroflexin OS=Dictyostelium discoideum GN=sfxn PE=3 SV=1 14 353 5.0E-72
sp|Q925N0|SFXN5_MOUSE Sideroflexin-5 OS=Mus musculus GN=Sfxn5 PE=1 SV=2 15 353 5.0E-59
sp|Q8CFD0|SFXN5_RAT Sideroflexin-5 OS=Rattus norvegicus GN=Sfxn5 PE=2 SV=1 15 353 7.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13793|FSF1_SCHPO Probable mitochondrial transport protein fsf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fsf1 PE=3 SV=2 10 353 5.0E-118
sp|Q12029|FSF1_YEAST Probable mitochondrial transport protein FSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FSF1 PE=1 SV=1 1 353 1.0E-111
sp|Q54NQ9|SFXN_DICDI Sideroflexin OS=Dictyostelium discoideum GN=sfxn PE=3 SV=1 14 353 5.0E-72
sp|Q925N0|SFXN5_MOUSE Sideroflexin-5 OS=Mus musculus GN=Sfxn5 PE=1 SV=2 15 353 5.0E-59
sp|Q8CFD0|SFXN5_RAT Sideroflexin-5 OS=Rattus norvegicus GN=Sfxn5 PE=2 SV=1 15 353 7.0E-59
sp|Q8TD22|SFXN5_HUMAN Sideroflexin-5 OS=Homo sapiens GN=SFXN5 PE=1 SV=1 15 353 8.0E-59
sp|B2LU20|SFXN1_SHEEP Sideroflexin-1 OS=Ovis aries GN=SFXN1 PE=2 SV=1 1 353 4.0E-51
sp|Q9H9B4|SFXN1_HUMAN Sideroflexin-1 OS=Homo sapiens GN=SFXN1 PE=1 SV=4 1 353 8.0E-51
sp|Q5RD16|SFXN3_PONAB Sideroflexin-3 OS=Pongo abelii GN=SFXN3 PE=2 SV=1 10 353 2.0E-50
sp|Q9BWM7|SFXN3_HUMAN Sideroflexin-3 OS=Homo sapiens GN=SFXN3 PE=1 SV=2 10 353 2.0E-50
sp|Q5E9M8|SFXN1_BOVIN Sideroflexin-1 OS=Bos taurus GN=SFXN1 PE=2 SV=3 1 353 3.0E-50
sp|A5A761|SFXN1_PIG Sideroflexin-1 OS=Sus scrofa GN=SFXN1 PE=2 SV=1 1 353 4.0E-50
sp|Q5FC79|SFXN5_CAEEL Sideroflexin-5 OS=Caenorhabditis elegans GN=sfxn-5 PE=3 SV=1 19 353 1.0E-49
sp|Q91V61|SFXN3_MOUSE Sideroflexin-3 OS=Mus musculus GN=Sfxn3 PE=1 SV=1 4 353 2.0E-48
sp|Q9JHY2|SFXN3_RAT Sideroflexin-3 OS=Rattus norvegicus GN=Sfxn3 PE=2 SV=1 4 353 4.0E-48
sp|A6QP55|SFXN3_BOVIN Sideroflexin-3 OS=Bos taurus GN=SFXN3 PE=2 SV=1 10 353 1.0E-46
sp|Q99JR1|SFXN1_MOUSE Sideroflexin-1 OS=Mus musculus GN=Sfxn1 PE=1 SV=3 1 353 1.0E-46
sp|Q63965|SFXN1_RAT Sideroflexin-1 OS=Rattus norvegicus GN=Sfxn1 PE=2 SV=4 1 353 7.0E-46
sp|Q09201|SFXN1_CAEEL Putative sideroflexin-1.1 OS=Caenorhabditis elegans GN=sfxn-1.1 PE=3 SV=1 15 353 9.0E-42
sp|Q925N2|SFXN2_MOUSE Sideroflexin-2 OS=Mus musculus GN=Sfxn2 PE=1 SV=1 15 353 6.0E-37
sp|Q5EA43|SFXN2_BOVIN Sideroflexin-2 OS=Bos taurus GN=SFXN2 PE=2 SV=2 15 353 5.0E-36
sp|Q96NB2|SFXN2_HUMAN Sideroflexin-2 OS=Homo sapiens GN=SFXN2 PE=1 SV=2 1 353 2.0E-35
sp|A8E7G5|SFXN4_DANRE Sideroflexin-4 OS=Danio rerio GN=sfxn4 PE=2 SV=1 15 353 3.0E-13
sp|Q6P4A7|SFXN4_HUMAN Sideroflexin-4 OS=Homo sapiens GN=SFXN4 PE=1 SV=1 20 353 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0006811 ion transport Yes
GO:0015075 ion transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 300 322 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4194
MTSSLPGHRELPVSQYDLSTYMGRVRHAIGITDPSTLFAGTSGLERAKQLVTDYKTGKTQRMTAELWQAKKIVDS
TLHPDTGEPVFLPFRMSCFVITNLIVTAGMLQPGLKTAGTLAWQVANQSVNVAVNSANANKSSPMTTAMLAQSYA
VAVTASCSVALGLNQLVPRLRVSDGARNVLGRLVPFAAVASAGALNAYLMRRGEIETGIEVRPVLSAEERGRLQR
EGRSERDVPALGRSRKAARLAVYETAASRVFNSSPVMVIPPLLLYHIQRRQPWYRRLMARDWVRARPRLATTIPI
GINLGLIAATAFAVLPLALAVFPQQQQISADSLEAEFHGKGGSNGKVWFNRGL*
Coding >Hirsu2|4194
ATGACGTCCTCGCTGCCGGGCCATCGCGAGCTGCCCGTGTCGCAGTATGACTTGAGCACGTACATGGGCCGGGTG
CGCCACGCGATCGGCATCACGGATCCCAGCACCCTCTTCGCCGGCACGTCCGGGCTCGAGAGGGCCAAGCAGCTG
GTGACGGACTACAAGACGGGCAAGACGCAGCGGATGACGGCGGAGCTGTGGCAGGCCAAGAAGATTGTCGACTCG
ACGCTGCACCCCGACACGGGCGAGCCCGTCTTCCTCCCGTTCCGGATGTCGTGCTTCGTCATCACGAACCTGATC
GTGACGGCCGGCATGCTCCAGCCCGGGCTGAAGACGGCGGGGACGCTGGCGTGGCAGGTGGCGAACCAGTCGGTC
AACGTGGCGGTCAACAGCGCCAACGCCAACAAGTCGTCGCCGATGACGACGGCGATGCTGGCGCAGTCGTACGCG
GTGGCGGTGACGGCCTCGTGCTCGGTCGCGCTCGGCCTCAACCAGCTGGTGCCGCGGCTGCGGGTGTCGGACGGG
GCGCGCAACGTGCTGGGGCGGCTGGTGCCGTTCGCGGCCGTGGCCTCGGCCGGCGCGCTCAACGCCTACCTGATG
CGGCGGGGCGAGATCGAGACGGGCATCGAGGTGCGGCCGGTGCTGTCGGCCGAGGAGCGGGGCCGGCTGCAGCGC
GAGGGCCGGTCGGAGCGCGACGTGCCGGCGCTGGGCCGGAGCCGCAAGGCGGCCCGGCTGGCCGTGTACGAGACG
GCCGCCAGCCGCGTCTTCAACAGCAGCCCCGTCATGGTCATCCCGCCGCTGCTGCTGTACCACATCCAGCGGCGC
CAGCCATGGTACCGGCGCCTGATGGCCCGCGACTGGGTCCGGGCCCGGCCGCGGCTGGCGACGACGATCCCCATC
GGCATCAACCTCGGCCTCATCGCCGCCACCGCCTTTGCCGTCCTGCCGCTCGCCCTCGCCGTCTTCCCGCAGCAG
CAGCAGATCTCGGCCGACAGCCTCGAGGCCGAGTTCCACGGCAAGGGCGGCAGCAATGGCAAGGTCTGGTTCAAC
CGCGGCCTCTGA
Transcript >Hirsu2|4194
ATGACGTCCTCGCTGCCGGGCCATCGCGAGCTGCCCGTGTCGCAGTATGACTTGAGCACGTACATGGGCCGGGTG
CGCCACGCGATCGGCATCACGGATCCCAGCACCCTCTTCGCCGGCACGTCCGGGCTCGAGAGGGCCAAGCAGCTG
GTGACGGACTACAAGACGGGCAAGACGCAGCGGATGACGGCGGAGCTGTGGCAGGCCAAGAAGATTGTCGACTCG
ACGCTGCACCCCGACACGGGCGAGCCCGTCTTCCTCCCGTTCCGGATGTCGTGCTTCGTCATCACGAACCTGATC
GTGACGGCCGGCATGCTCCAGCCCGGGCTGAAGACGGCGGGGACGCTGGCGTGGCAGGTGGCGAACCAGTCGGTC
AACGTGGCGGTCAACAGCGCCAACGCCAACAAGTCGTCGCCGATGACGACGGCGATGCTGGCGCAGTCGTACGCG
GTGGCGGTGACGGCCTCGTGCTCGGTCGCGCTCGGCCTCAACCAGCTGGTGCCGCGGCTGCGGGTGTCGGACGGG
GCGCGCAACGTGCTGGGGCGGCTGGTGCCGTTCGCGGCCGTGGCCTCGGCCGGCGCGCTCAACGCCTACCTGATG
CGGCGGGGCGAGATCGAGACGGGCATCGAGGTGCGGCCGGTGCTGTCGGCCGAGGAGCGGGGCCGGCTGCAGCGC
GAGGGCCGGTCGGAGCGCGACGTGCCGGCGCTGGGCCGGAGCCGCAAGGCGGCCCGGCTGGCCGTGTACGAGACG
GCCGCCAGCCGCGTCTTCAACAGCAGCCCCGTCATGGTCATCCCGCCGCTGCTGCTGTACCACATCCAGCGGCGC
CAGCCATGGTACCGGCGCCTGATGGCCCGCGACTGGGTCCGGGCCCGGCCGCGGCTGGCGACGACGATCCCCATC
GGCATCAACCTCGGCCTCATCGCCGCCACCGCCTTTGCCGTCCTGCCGCTCGCCCTCGCCGTCTTCCCGCAGCAG
CAGCAGATCTCGGCCGACAGCCTCGAGGCCGAGTTCCACGGCAAGGGCGGCAGCAATGGCAAGGTCTGGTTCAAC
CGCGGCCTCTGA
Gene >Hirsu2|4194
ATGACGTCCTCGCTGCCGGGCCATCGCGAGCTGCCCGTGTCGCAGTATGACTTGAGCACGTACATGGGCCGGGTG
CGCCACGCGATCGGCATCACGGATCCCAGGTGAGGCCCGCACGATCAGGGGAGAAATGGGCGAGCGAGCGGGCGG
CTGACAGGTCACAGCACCCTCTTCGCCGGCACGTCCGGGCTCGAGAGGGCCAAGCAGCTGGTGACGGACTACAAG
ACGGGCAAGACGCAGCGGATGACGGCGGAGCTGTGGCAGGCCAAGAAGATTGTCGACTCGACGCTGCACCCCGGT
ACGGAGGACGAAGGCGCGCGGCGGGGAGACAGAACGAAGGCTGACGCGGGCAAGCAGACACGGGCGAGCCCGTCT
TCCTCCCGTTCCGGATGTCGTGCTTCGTCATCACGAACCTGATCGTGACGGCCGGCATGCTCCAGCCCGGGCTGA
AGACGGCGGGGACGCTGGCGTGGCAGGTGGCGAACCAGTCGGTCAACGTGGCGGTCAACAGCGCCAACGCCAACA
AGTCGTCGCCGATGACGACGGCGATGCTGGCGCAGTCGTACGCGGTGGCGGTGACGGCCTCGTGCTCGGTCGCGC
TCGGCCTCAACCAGCTGGTGCCGCGGCTGCGGGTGTCGGACGGGGCGCGCAACGTGCTGGGGCGGCTGGTGCCGT
TCGCGGCCGTGGCCTCGGCCGGCGCGCTCAACGCCTACCTGATGCGGCGGGGCGAGATCGAGACGGGCATCGAGG
TGCGGCCGGTGCTGTCGGCCGAGGAGCGGGGCCGGCTGCAGCGCGAGGGCCGGTCGGAGCGCGACGTGCCGGCGC
TGGGCCGGAGCCGCAAGGCGGCCCGGCTGGCCGTGTACGAGACGGCCGCCAGCCGCGTCTTCAACAGCAGCCCCG
TCATGGTCATCCCGCCGCTGCTGCTGTACCACATCCAGCGGCGCCAGCCATGGTACCGGCGCCTGATGGCCCGCG
ACTGGGTCCGGGCCCGGCCGCGGCTGGCGACGACGATCCCCATCGGCATCAACCTCGGCCTCATCGCCGCCACCG
CCTTTGCCGTCCTGCCGCTCGCCCTCGCCGTCTTCCCGCAGCAGCAGCAGATCTCGGCCGACAGCCTCGAGGCCG
AGTTCCACGGCAAGGGCGGCAGCAATGGCAAGGTCTGGTTCAACCGCGGCCTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail