Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4193
Gene name
LocationContig_216:3499..6685
Strand-
Gene length (bp)3186
Transcript length (bp)3186
Coding sequence length (bp)3186
Protein length (aa) 1062

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01388 ARID ARID/BRIGHT DNA binding domain 4.0E-16 363 447

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74365|SOL1_SCHPO SWI/SNF chromatin-remodeling complex subunit sol1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sol1 PE=1 SV=1 283 1038 1.0E-36
sp|A2CG63|ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus GN=Arid4b PE=1 SV=1 364 448 2.0E-08
sp|Q4LE39|ARI4B_HUMAN AT-rich interactive domain-containing protein 4B OS=Homo sapiens GN=ARID4B PE=1 SV=2 364 448 3.0E-08
sp|Q9JKB5|ARI4B_RAT AT-rich interactive domain-containing protein 4B OS=Rattus norvegicus GN=Arid4b PE=1 SV=1 364 448 3.0E-08
sp|P09547|SWI1_YEAST SWI/SNF chromatin-remodeling complex subunit SWI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI1 PE=1 SV=1 738 890 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74365|SOL1_SCHPO SWI/SNF chromatin-remodeling complex subunit sol1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sol1 PE=1 SV=1 283 1038 1.0E-36
sp|A2CG63|ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus GN=Arid4b PE=1 SV=1 364 448 2.0E-08
sp|Q4LE39|ARI4B_HUMAN AT-rich interactive domain-containing protein 4B OS=Homo sapiens GN=ARID4B PE=1 SV=2 364 448 3.0E-08
sp|Q9JKB5|ARI4B_RAT AT-rich interactive domain-containing protein 4B OS=Rattus norvegicus GN=Arid4b PE=1 SV=1 364 448 3.0E-08
sp|P09547|SWI1_YEAST SWI/SNF chromatin-remodeling complex subunit SWI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI1 PE=1 SV=1 738 890 1.0E-07
sp|A6PWV5|ARI3C_MOUSE AT-rich interactive domain-containing protein 3C OS=Mus musculus GN=Arid3c PE=2 SV=2 363 447 2.0E-06
sp|A6NKF2|ARI3C_HUMAN AT-rich interactive domain-containing protein 3C OS=Homo sapiens GN=ARID3C PE=3 SV=1 363 447 3.0E-06
sp|P09547|SWI1_YEAST SWI/SNF chromatin-remodeling complex subunit SWI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWI1 PE=1 SV=1 577 758 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5244 0.7896 0.1396 0.0829 0.033 0.0032 0.0687 0.0142 0.0259 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
ARID/BRIGHT

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2687
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2565
Ophiocordyceps australis map64 (Brazil) OphauB2|6611
Ophiocordyceps camponoti-floridani Ophcf2|05218
Ophiocordyceps camponoti-rufipedis Ophun1|4251
Ophiocordyceps kimflemingae Ophio5|7960
Ophiocordyceps subramaniannii Hirsu2|4193 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4193
MSTPTTAVATLPRYHSHYHHHPPPYPHHQHPHQHPHPHPHQQQQMAGMQNGPMRHASPTAYPNQSQSQTPNPVYQ
TNSVIPSKRPRPREDSITGSPIQNPGMQPPSRSETPQQQQQQQQQQNFAAFQPQQPAGQFPHLQPNGSANASPSP
IMGNQMRPGTVPQRVATASPHPFSPGAQQFAPGSQTSPVPSEHGTPQPNTYMQNMPPGYNPGFAPSPSNPRPSPN
PNAMAAGQMMPQQMAQVPQHMGQMPPNMYQQMQQQQQQQQQQGQPPPPPQQQQGQPQQGQPPHQQRPPNMTDQQK
MAAYQMRLQQQLQGNMQMQAQMQAQNMGRGVMPKQQMPGMPNGQMPPAGMRPQPRPMANINPEHFMKNLTALMNA
KGLPLDPNPVVGDRQISLVMLFQIVQSRGGYKAVTAANGWLHVGQALGLPVQIPTVAPTLKQVYERNLQKFEEVW
VAQQKQRMMQQNVTMAGQGAPQRHLQPSQPLNQGQMPPGHPPHPQQQAPTKPGQVPMNGYPAPQAQQPQQPGVVP
GHSRNSLSHGMDPSAAGDFSMPSPAHHRTGSLRMNPGDGRASAPLAMTDTDQAVPRMPPRSDEYNPCARELLTYG
GIDLSAADLLGSELSRWEPSVPTINELGNIDIHALTRSLQSGIHGEVRLALDTLATVSASLGQMHFMQLRYCDDL
VDALVDCAEEQLDLLAEHTVEVSDEILLTPYEDVVRACRLEALAIKDVPAFGTTEYRLDRAVDKLICITTIMRNA
SFPGDQNDNHNFLSDESVIKMLCVVIRYLGTRTMLLRTHGNTLDFMKDVVVLLSNIAGSVELPGREQAQCLLQFL
LAFAPTPGPTTTDDTLFFAPYDPSLHPYTPHAVDALAKILARDEPNRSFYKYLFAADGTGSSAYELLTRTFALAV
SPIPEKAKEETRPPHAPSLVDWRKPFVMQGLLAAEILASMAPGPETGLARSWLASGGSFAQNLYRLVQELSVLYE
KHPMAGRVPGRGPSRRDPELVYIVVVAVALLKRLVDKAGDPNSATCAVSSDFLPQTQLLVHALSMGSAEWTKEGM
LLQLTSIFNYR*
Coding >Hirsu2|4193
ATGTCGACGCCCACGACGGCCGTCGCTACGCTTCCTCGCTACCACTCGCACTACCACCACCACCCGCCGCCATAT
CCGCACCACCAGCACCCGCACCAGCACCCGCACCCGCACCCGCACCAGCAGCAGCAAATGGCTGGCATGCAGAAC
GGCCCCATGCGCCATGCCTCGCCGACCGCCTACCCGAACCAGAGCCAGAGCCAGACGCCAAACCCCGTCTACCAG
ACAAACTCCGTCATCCCATCGAAGCGTCCCCGACCGCGCGAAGACAGCATCACCGGCTCCCCGATACAGAACCCG
GGCATGCAGCCGCCGTCGCGCTCCGAAACGCCGCAACAGCAGCAGCAGCAACAACAACAACAAAACTTTGCCGCC
TTCCAGCCCCAGCAGCCTGCCGGCCAGTTCCCCCATCTCCAACCGAATGGCTCCGCCAACGCCAGCCCCTCGCCC
ATCATGGGCAACCAGATGCGACCCGGCACCGTGCCCCAGCGAGTGGCCACGGCCTCGCCCCATCCCTTCTCGCCC
GGCGCCCAGCAGTTCGCCCCCGGCTCCCAGACGTCGCCCGTTCCGTCGGAGCACGGCACTCCCCAGCCGAACACA
TATATGCAAAACATGCCGCCCGGCTACAACCCCGGCTTCGCGCCCTCGCCCTCGAACCCTCGTCCCTCGCCGAAC
CCGAACGCCATGGCCGCTGGCCAGATGATGCCGCAACAGATGGCCCAGGTGCCGCAGCACATGGGCCAGATGCCG
CCCAACATGTACCAGCAGATGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGGCCAGCCGCCGCCGCCGCCGCAG
CAGCAGCAGGGCCAGCCGCAGCAGGGCCAGCCGCCGCATCAGCAGCGCCCGCCCAACATGACGGATCAGCAGAAG
ATGGCGGCGTACCAGATGCGACTCCAGCAGCAGCTACAGGGAAACATGCAGATGCAGGCCCAGATGCAGGCCCAG
AACATGGGCCGGGGCGTGATGCCGAAGCAGCAGATGCCCGGCATGCCCAACGGCCAGATGCCCCCGGCCGGCATG
CGGCCGCAGCCTCGGCCCATGGCCAACATCAACCCGGAGCACTTCATGAAGAATCTCACCGCGCTAATGAATGCC
AAGGGACTGCCTCTCGACCCGAACCCCGTCGTCGGCGATCGACAGATCAGCCTCGTCATGCTCTTCCAGATCGTG
CAATCGAGGGGCGGCTACAAGGCGGTAACGGCAGCCAACGGATGGCTTCACGTCGGCCAGGCTCTCGGGCTACCG
GTACAGATCCCGACGGTCGCGCCGACGTTGAAGCAGGTCTACGAACGGAACCTGCAAAAGTTCGAGGAGGTCTGG
GTGGCGCAGCAAAAGCAAAGAATGATGCAGCAAAACGTGACCATGGCCGGCCAGGGCGCGCCGCAGAGGCACCTG
CAACCCAGCCAGCCGCTGAACCAGGGCCAGATGCCGCCGGGGCACCCTCCGCACCCGCAACAGCAGGCGCCGACG
AAGCCCGGCCAGGTCCCCATGAACGGCTACCCCGCGCCGCAGGCCCAGCAGCCGCAGCAACCCGGCGTCGTGCCC
GGCCATAGCAGGAACAGCCTGTCCCACGGCATGGACCCTTCCGCGGCCGGCGACTTCTCGATGCCCTCTCCCGCG
CATCACCGGACCGGCAGCCTGCGCATGAATCCGGGCGACGGCCGAGCCTCGGCCCCCCTCGCCATGACCGACACG
GACCAAGCGGTGCCGCGAATGCCGCCGAGGTCCGACGAATACAACCCCTGCGCGCGCGAGCTGTTGACGTACGGC
GGCATCGACCTCAGCGCCGCCGACCTGCTGGGCTCCGAGCTGTCCAGGTGGGAGCCGTCCGTCCCGACGATCAAC
GAGCTCGGCAACATCGACATCCACGCCCTGACGCGAAGCCTGCAGAGCGGCATACACGGAGAAGTGCGCCTTGCC
CTCGACACGCTGGCGACGGTGTCGGCATCCCTCGGCCAGATGCACTTCATGCAGCTGAGGTACTGCGACGACCTG
GTCGATGCCCTCGTCGACTGCGCCGAGGAGCAGCTCGACTTGCTGGCCGAGCACACGGTCGAGGTGTCGGACGAA
ATCCTGCTGACCCCCTACGAAGACGTCGTCCGAGCCTGCCGCCTCGAGGCCCTGGCCATCAAGGACGTGCCCGCC
TTCGGCACGACCGAGTACCGGCTCGACCGCGCGGTGGACAAGCTGATATGCATCACGACAATCATGCGCAACGCG
TCGTTTCCCGGCGACCAAAACGACAACCACAACTTCCTGTCGGACGAATCCGTCATCAAGATGCTCTGTGTCGTC
ATCCGGTACCTGGGCACACGCACCATGCTGCTCCGCACCCACGGCAACACGCTGGATTTCATGAAGGACGTGGTT
GTGCTGCTGTCCAACATTGCCGGCTCGGTCGAGCTCCCCGGGCGGGAGCAGGCACAGTGTCTCTTGCAGTTCCTT
CTGGCCTTCGCCCCGACGCCGGGCCCGACGACGACCGACGACACCCTCTTCTTCGCGCCCTACGACCCGAGCCTC
CACCCCTACACGCCCCACGCCGTCGACGCCCTCGCCAAGATCCTCGCCCGAGACGAGCCGAACCGCAGCTTCTAC
AAATACCTGTTCGCCGCCGACGGCACGGGCTCCTCGGCCTACGAGCTCCTGACCCGGACCTTCGCCCTGGCCGTG
TCGCCCATCCCGGAGAAGGCCAAGGAGGAGACGCGACCGCCGCACGCCCCTTCGCTCGTCGACTGGCGGAAGCCG
TTTGTGATGCAGGGCCTGCTGGCGGCCGAGATACTCGCGTCGATGGCACCCGGCCCCGAGACCGGGCTGGCCCGG
AGCTGGCTCGCCTCGGGCGGCAGTTTCGCCCAGAACCTGTACAGGCTGGTCCAGGAGCTGAGCGTCCTGTACGAG
AAACACCCGATGGCGGGCCGCGTCCCGGGCCGTGGTCCCTCGAGGAGGGACCCGGAGCTCGTCTACATCGTCGTG
GTCGCGGTCGCGCTCCTCAAGAGGCTGGTCGACAAGGCCGGGGACCCCAACAGCGCGACGTGCGCGGTTTCGTCG
GATTTCCTCCCGCAAACGCAACTGCTCGTCCACGCGCTATCCATGGGATCCGCCGAGTGGACGAAGGAGGGGATG
CTTCTGCAGCTGACGTCCATATTCAACTATCGTTAG
Transcript >Hirsu2|4193
ATGTCGACGCCCACGACGGCCGTCGCTACGCTTCCTCGCTACCACTCGCACTACCACCACCACCCGCCGCCATAT
CCGCACCACCAGCACCCGCACCAGCACCCGCACCCGCACCCGCACCAGCAGCAGCAAATGGCTGGCATGCAGAAC
GGCCCCATGCGCCATGCCTCGCCGACCGCCTACCCGAACCAGAGCCAGAGCCAGACGCCAAACCCCGTCTACCAG
ACAAACTCCGTCATCCCATCGAAGCGTCCCCGACCGCGCGAAGACAGCATCACCGGCTCCCCGATACAGAACCCG
GGCATGCAGCCGCCGTCGCGCTCCGAAACGCCGCAACAGCAGCAGCAGCAACAACAACAACAAAACTTTGCCGCC
TTCCAGCCCCAGCAGCCTGCCGGCCAGTTCCCCCATCTCCAACCGAATGGCTCCGCCAACGCCAGCCCCTCGCCC
ATCATGGGCAACCAGATGCGACCCGGCACCGTGCCCCAGCGAGTGGCCACGGCCTCGCCCCATCCCTTCTCGCCC
GGCGCCCAGCAGTTCGCCCCCGGCTCCCAGACGTCGCCCGTTCCGTCGGAGCACGGCACTCCCCAGCCGAACACA
TATATGCAAAACATGCCGCCCGGCTACAACCCCGGCTTCGCGCCCTCGCCCTCGAACCCTCGTCCCTCGCCGAAC
CCGAACGCCATGGCCGCTGGCCAGATGATGCCGCAACAGATGGCCCAGGTGCCGCAGCACATGGGCCAGATGCCG
CCCAACATGTACCAGCAGATGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGGCCAGCCGCCGCCGCCGCCGCAG
CAGCAGCAGGGCCAGCCGCAGCAGGGCCAGCCGCCGCATCAGCAGCGCCCGCCCAACATGACGGATCAGCAGAAG
ATGGCGGCGTACCAGATGCGACTCCAGCAGCAGCTACAGGGAAACATGCAGATGCAGGCCCAGATGCAGGCCCAG
AACATGGGCCGGGGCGTGATGCCGAAGCAGCAGATGCCCGGCATGCCCAACGGCCAGATGCCCCCGGCCGGCATG
CGGCCGCAGCCTCGGCCCATGGCCAACATCAACCCGGAGCACTTCATGAAGAATCTCACCGCGCTAATGAATGCC
AAGGGACTGCCTCTCGACCCGAACCCCGTCGTCGGCGATCGACAGATCAGCCTCGTCATGCTCTTCCAGATCGTG
CAATCGAGGGGCGGCTACAAGGCGGTAACGGCAGCCAACGGATGGCTTCACGTCGGCCAGGCTCTCGGGCTACCG
GTACAGATCCCGACGGTCGCGCCGACGTTGAAGCAGGTCTACGAACGGAACCTGCAAAAGTTCGAGGAGGTCTGG
GTGGCGCAGCAAAAGCAAAGAATGATGCAGCAAAACGTGACCATGGCCGGCCAGGGCGCGCCGCAGAGGCACCTG
CAACCCAGCCAGCCGCTGAACCAGGGCCAGATGCCGCCGGGGCACCCTCCGCACCCGCAACAGCAGGCGCCGACG
AAGCCCGGCCAGGTCCCCATGAACGGCTACCCCGCGCCGCAGGCCCAGCAGCCGCAGCAACCCGGCGTCGTGCCC
GGCCATAGCAGGAACAGCCTGTCCCACGGCATGGACCCTTCCGCGGCCGGCGACTTCTCGATGCCCTCTCCCGCG
CATCACCGGACCGGCAGCCTGCGCATGAATCCGGGCGACGGCCGAGCCTCGGCCCCCCTCGCCATGACCGACACG
GACCAAGCGGTGCCGCGAATGCCGCCGAGGTCCGACGAATACAACCCCTGCGCGCGCGAGCTGTTGACGTACGGC
GGCATCGACCTCAGCGCCGCCGACCTGCTGGGCTCCGAGCTGTCCAGGTGGGAGCCGTCCGTCCCGACGATCAAC
GAGCTCGGCAACATCGACATCCACGCCCTGACGCGAAGCCTGCAGAGCGGCATACACGGAGAAGTGCGCCTTGCC
CTCGACACGCTGGCGACGGTGTCGGCATCCCTCGGCCAGATGCACTTCATGCAGCTGAGGTACTGCGACGACCTG
GTCGATGCCCTCGTCGACTGCGCCGAGGAGCAGCTCGACTTGCTGGCCGAGCACACGGTCGAGGTGTCGGACGAA
ATCCTGCTGACCCCCTACGAAGACGTCGTCCGAGCCTGCCGCCTCGAGGCCCTGGCCATCAAGGACGTGCCCGCC
TTCGGCACGACCGAGTACCGGCTCGACCGCGCGGTGGACAAGCTGATATGCATCACGACAATCATGCGCAACGCG
TCGTTTCCCGGCGACCAAAACGACAACCACAACTTCCTGTCGGACGAATCCGTCATCAAGATGCTCTGTGTCGTC
ATCCGGTACCTGGGCACACGCACCATGCTGCTCCGCACCCACGGCAACACGCTGGATTTCATGAAGGACGTGGTT
GTGCTGCTGTCCAACATTGCCGGCTCGGTCGAGCTCCCCGGGCGGGAGCAGGCACAGTGTCTCTTGCAGTTCCTT
CTGGCCTTCGCCCCGACGCCGGGCCCGACGACGACCGACGACACCCTCTTCTTCGCGCCCTACGACCCGAGCCTC
CACCCCTACACGCCCCACGCCGTCGACGCCCTCGCCAAGATCCTCGCCCGAGACGAGCCGAACCGCAGCTTCTAC
AAATACCTGTTCGCCGCCGACGGCACGGGCTCCTCGGCCTACGAGCTCCTGACCCGGACCTTCGCCCTGGCCGTG
TCGCCCATCCCGGAGAAGGCCAAGGAGGAGACGCGACCGCCGCACGCCCCTTCGCTCGTCGACTGGCGGAAGCCG
TTTGTGATGCAGGGCCTGCTGGCGGCCGAGATACTCGCGTCGATGGCACCCGGCCCCGAGACCGGGCTGGCCCGG
AGCTGGCTCGCCTCGGGCGGCAGTTTCGCCCAGAACCTGTACAGGCTGGTCCAGGAGCTGAGCGTCCTGTACGAG
AAACACCCGATGGCGGGCCGCGTCCCGGGCCGTGGTCCCTCGAGGAGGGACCCGGAGCTCGTCTACATCGTCGTG
GTCGCGGTCGCGCTCCTCAAGAGGCTGGTCGACAAGGCCGGGGACCCCAACAGCGCGACGTGCGCGGTTTCGTCG
GATTTCCTCCCGCAAACGCAACTGCTCGTCCACGCGCTATCCATGGGATCCGCCGAGTGGACGAAGGAGGGGATG
CTTCTGCAGCTGACGTCCATATTCAACTATCGTTAG
Gene >Hirsu2|4193
ATGTCGACGCCCACGACGGCCGTCGCTACGCTTCCTCGCTACCACTCGCACTACCACCACCACCCGCCGCCATAT
CCGCACCACCAGCACCCGCACCAGCACCCGCACCCGCACCCGCACCAGCAGCAGCAAATGGCTGGCATGCAGAAC
GGCCCCATGCGCCATGCCTCGCCGACCGCCTACCCGAACCAGAGCCAGAGCCAGACGCCAAACCCCGTCTACCAG
ACAAACTCCGTCATCCCATCGAAGCGTCCCCGACCGCGCGAAGACAGCATCACCGGCTCCCCGATACAGAACCCG
GGCATGCAGCCGCCGTCGCGCTCCGAAACGCCGCAACAGCAGCAGCAGCAACAACAACAACAAAACTTTGCCGCC
TTCCAGCCCCAGCAGCCTGCCGGCCAGTTCCCCCATCTCCAACCGAATGGCTCCGCCAACGCCAGCCCCTCGCCC
ATCATGGGCAACCAGATGCGACCCGGCACCGTGCCCCAGCGAGTGGCCACGGCCTCGCCCCATCCCTTCTCGCCC
GGCGCCCAGCAGTTCGCCCCCGGCTCCCAGACGTCGCCCGTTCCGTCGGAGCACGGCACTCCCCAGCCGAACACA
TATATGCAAAACATGCCGCCCGGCTACAACCCCGGCTTCGCGCCCTCGCCCTCGAACCCTCGTCCCTCGCCGAAC
CCGAACGCCATGGCCGCTGGCCAGATGATGCCGCAACAGATGGCCCAGGTGCCGCAGCACATGGGCCAGATGCCG
CCCAACATGTACCAGCAGATGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGGCCAGCCGCCGCCGCCGCCGCAG
CAGCAGCAGGGCCAGCCGCAGCAGGGCCAGCCGCCGCATCAGCAGCGCCCGCCCAACATGACGGATCAGCAGAAG
ATGGCGGCGTACCAGATGCGACTCCAGCAGCAGCTACAGGGAAACATGCAGATGCAGGCCCAGATGCAGGCCCAG
AACATGGGCCGGGGCGTGATGCCGAAGCAGCAGATGCCCGGCATGCCCAACGGCCAGATGCCCCCGGCCGGCATG
CGGCCGCAGCCTCGGCCCATGGCCAACATCAACCCGGAGCACTTCATGAAGAATCTCACCGCGCTAATGAATGCC
AAGGGACTGCCTCTCGACCCGAACCCCGTCGTCGGCGATCGACAGATCAGCCTCGTCATGCTCTTCCAGATCGTG
CAATCGAGGGGCGGCTACAAGGCGGTAACGGCAGCCAACGGATGGCTTCACGTCGGCCAGGCTCTCGGGCTACCG
GTACAGATCCCGACGGTCGCGCCGACGTTGAAGCAGGTCTACGAACGGAACCTGCAAAAGTTCGAGGAGGTCTGG
GTGGCGCAGCAAAAGCAAAGAATGATGCAGCAAAACGTGACCATGGCCGGCCAGGGCGCGCCGCAGAGGCACCTG
CAACCCAGCCAGCCGCTGAACCAGGGCCAGATGCCGCCGGGGCACCCTCCGCACCCGCAACAGCAGGCGCCGACG
AAGCCCGGCCAGGTCCCCATGAACGGCTACCCCGCGCCGCAGGCCCAGCAGCCGCAGCAACCCGGCGTCGTGCCC
GGCCATAGCAGGAACAGCCTGTCCCACGGCATGGACCCTTCCGCGGCCGGCGACTTCTCGATGCCCTCTCCCGCG
CATCACCGGACCGGCAGCCTGCGCATGAATCCGGGCGACGGCCGAGCCTCGGCCCCCCTCGCCATGACCGACACG
GACCAAGCGGTGCCGCGAATGCCGCCGAGGTCCGACGAATACAACCCCTGCGCGCGCGAGCTGTTGACGTACGGC
GGCATCGACCTCAGCGCCGCCGACCTGCTGGGCTCCGAGCTGTCCAGGTGGGAGCCGTCCGTCCCGACGATCAAC
GAGCTCGGCAACATCGACATCCACGCCCTGACGCGAAGCCTGCAGAGCGGCATACACGGAGAAGTGCGCCTTGCC
CTCGACACGCTGGCGACGGTGTCGGCATCCCTCGGCCAGATGCACTTCATGCAGCTGAGGTACTGCGACGACCTG
GTCGATGCCCTCGTCGACTGCGCCGAGGAGCAGCTCGACTTGCTGGCCGAGCACACGGTCGAGGTGTCGGACGAA
ATCCTGCTGACCCCCTACGAAGACGTCGTCCGAGCCTGCCGCCTCGAGGCCCTGGCCATCAAGGACGTGCCCGCC
TTCGGCACGACCGAGTACCGGCTCGACCGCGCGGTGGACAAGCTGATATGCATCACGACAATCATGCGCAACGCG
TCGTTTCCCGGCGACCAAAACGACAACCACAACTTCCTGTCGGACGAATCCGTCATCAAGATGCTCTGTGTCGTC
ATCCGGTACCTGGGCACACGCACCATGCTGCTCCGCACCCACGGCAACACGCTGGATTTCATGAAGGACGTGGTT
GTGCTGCTGTCCAACATTGCCGGCTCGGTCGAGCTCCCCGGGCGGGAGCAGGCACAGTGTCTCTTGCAGTTCCTT
CTGGCCTTCGCCCCGACGCCGGGCCCGACGACGACCGACGACACCCTCTTCTTCGCGCCCTACGACCCGAGCCTC
CACCCCTACACGCCCCACGCCGTCGACGCCCTCGCCAAGATCCTCGCCCGAGACGAGCCGAACCGCAGCTTCTAC
AAATACCTGTTCGCCGCCGACGGCACGGGCTCCTCGGCCTACGAGCTCCTGACCCGGACCTTCGCCCTGGCCGTG
TCGCCCATCCCGGAGAAGGCCAAGGAGGAGACGCGACCGCCGCACGCCCCTTCGCTCGTCGACTGGCGGAAGCCG
TTTGTGATGCAGGGCCTGCTGGCGGCCGAGATACTCGCGTCGATGGCACCCGGCCCCGAGACCGGGCTGGCCCGG
AGCTGGCTCGCCTCGGGCGGCAGTTTCGCCCAGAACCTGTACAGGCTGGTCCAGGAGCTGAGCGTCCTGTACGAG
AAACACCCGATGGCGGGCCGCGTCCCGGGCCGTGGTCCCTCGAGGAGGGACCCGGAGCTCGTCTACATCGTCGTG
GTCGCGGTCGCGCTCCTCAAGAGGCTGGTCGACAAGGCCGGGGACCCCAACAGCGCGACGTGCGCGGTTTCGTCG
GATTTCCTCCCGCAAACGCAACTGCTCGTCCACGCGCTATCCATGGGATCCGCCGAGTGGACGAAGGAGGGGATG
CTTCTGCAGCTGACGTCCATATTCAACTATCGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail