Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4192
Gene name
LocationContig_216:2437..3048
Strand+
Gene length (bp)611
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05046 Img2 Mitochondrial large subunit ribosomal protein (Img2) 1.2E-23 94 175

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10139|IMG2_SCHPO 54S ribosomal protein img2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=img2 PE=3 SV=1 93 175 1.0E-11
sp|Q9CQ40|RM49_MOUSE 39S ribosomal protein L49, mitochondrial OS=Mus musculus GN=Mrpl49 PE=1 SV=1 90 175 1.0E-08
sp|Q5EA71|RM49_BOVIN 39S ribosomal protein L49, mitochondrial OS=Bos taurus GN=MRPL49 PE=1 SV=1 95 175 2.0E-07
sp|Q5R8X0|RM49_PONAB 39S ribosomal protein L49, mitochondrial OS=Pongo abelii GN=MRPL49 PE=2 SV=1 95 175 4.0E-07
sp|Q13405|RM49_HUMAN 39S ribosomal protein L49, mitochondrial OS=Homo sapiens GN=MRPL49 PE=1 SV=1 95 175 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10139|IMG2_SCHPO 54S ribosomal protein img2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=img2 PE=3 SV=1 93 175 1.0E-11
sp|Q9CQ40|RM49_MOUSE 39S ribosomal protein L49, mitochondrial OS=Mus musculus GN=Mrpl49 PE=1 SV=1 90 175 1.0E-08
sp|Q5EA71|RM49_BOVIN 39S ribosomal protein L49, mitochondrial OS=Bos taurus GN=MRPL49 PE=1 SV=1 95 175 2.0E-07
sp|Q5R8X0|RM49_PONAB 39S ribosomal protein L49, mitochondrial OS=Pongo abelii GN=MRPL49 PE=2 SV=1 95 175 4.0E-07
sp|Q13405|RM49_HUMAN 39S ribosomal protein L49, mitochondrial OS=Homo sapiens GN=MRPL49 PE=1 SV=1 95 175 4.0E-07
sp|Q4R5K7|RM49_MACFA 39S ribosomal protein L49, mitochondrial OS=Macaca fascicularis GN=MRPL49 PE=2 SV=1 95 175 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005622 intracellular Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044267 cellular protein metabolic process No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4192
MSRLLSRIFFARAAALSSPRPPPPPPFLRIATSSSTASSSSSAYSTEAWQLDGPGASPKAIRRRARQQREEQRGP
DDLVTPPPTKTAEELARMPYVVRRTPSCQPPVYRDVRSGGTRKVVLIKKIEGDKQQMVRDLVEHLKIDREKVRIN
PITEHVEVKGDLLRPVKQWLLGSGF*
Coding >Hirsu2|4192
ATGAGCCGATTGCTCTCTCGAATCTTCTTCGCCCGCGCGGCCGCCCTCTCCTCGCCCCGGCCGCCGCCGCCGCCG
CCGTTCCTCCGAATCGCCACCTCCTCCTCCACCGCCTCCTCCTCCTCCTCCGCCTACTCGACCGAGGCCTGGCAG
CTGGACGGCCCCGGCGCCTCCCCCAAGGCCATCCGCAGGCGCGCGCGCCAGCAGCGCGAGGAGCAGCGCGGGCCC
GACGACCTCGTCACCCCGCCTCCCACCAAGACGGCCGAGGAGTTGGCGCGGATGCCCTACGTCGTCCGCCGCACG
CCCTCCTGCCAGCCGCCCGTCTATCGGGACGTCCGCTCGGGCGGCACCAGGAAGGTCGTCCTCATCAAGAAGATC
GAGGGCGACAAGCAACAAATGGTGCGCGACTTGGTCGAGCATCTGAAAATCGACCGCGAAAAGGTCAGGATCAAT
CCCATAACGGAACATGTCGAGGTCAAGGGCGACCTTCTCCGGCCAGTCAAGCAATGGCTGTTAGGCTCAGGCTTC
TAA
Transcript >Hirsu2|4192
ATGAGCCGATTGCTCTCTCGAATCTTCTTCGCCCGCGCGGCCGCCCTCTCCTCGCCCCGGCCGCCGCCGCCGCCG
CCGTTCCTCCGAATCGCCACCTCCTCCTCCACCGCCTCCTCCTCCTCCTCCGCCTACTCGACCGAGGCCTGGCAG
CTGGACGGCCCCGGCGCCTCCCCCAAGGCCATCCGCAGGCGCGCGCGCCAGCAGCGCGAGGAGCAGCGCGGGCCC
GACGACCTCGTCACCCCGCCTCCCACCAAGACGGCCGAGGAGTTGGCGCGGATGCCCTACGTCGTCCGCCGCACG
CCCTCCTGCCAGCCGCCCGTCTATCGGGACGTCCGCTCGGGCGGCACCAGGAAGGTCGTCCTCATCAAGAAGATC
GAGGGCGACAAGCAACAAATGGTGCGCGACTTGGTCGAGCATCTGAAAATCGACCGCGAAAAGGTCAGGATCAAT
CCCATAACGGAACATGTCGAGGTCAAGGGCGACCTTCTCCGGCCAGTCAAGCAATGGCTGTTAGGCTCAGGCTTC
TAA
Gene >Hirsu2|4192
ATGAGCCGATTGCTCTCTCGAATCTTCTTCGCCCGCGCGGCCGCCCTCTCCTCGCCCCGGCCGCCGCCGCCGCCG
CCGTTCCTCCGAATCGCCACCTCCTCCTCCACCGCCTCCTCCTCCTCCTCCGCCTACTCGACCGAGGCCTGGCAG
CTGGACGGCCCCGGCGCCTCCCCCAAGGCCATCCGCAGGCGCGCGCGCCAGCAGCGCGAGGAGCAGCGCGGGCCC
GACGACCTCGTCACCCCGCCTCCCACCAAGACGGCCGAGGAGTTGGCGCGGATGCCCTACGTCGTCCGCCGCACG
CCCTCCTGCCAGCCGCCCGTCTATCGGGACGTCCGCTCGGGCGGCACCAGGAAGGTCGTCCTCATCAAGAAGATC
GAGGGCGACAAGCAACAAATGGTGCGCGACTTGGTCGAGCATCTGAAAATCGACCGCGAAAAGGTCAGGATCAAT
CCCATAACGGAACATGTCGAGGTCAAGGTACGCACGCCCTCTCCGTCGCTCTTCCTTGCACCCTCAACGAGGAGC
GCGAGCCGCGCGAGACTCACACGCACAACTTGCAGGGCGACCTTCTCCGGCCAGTCAAGCAATGGCTGTTAGGCT
CAGGCTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail