Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4191
Gene name
LocationContig_216:505..1892
Strand-
Gene length (bp)1387
Transcript length (bp)1320
Coding sequence length (bp)1320
Protein length (aa) 440

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09440 eIF3_N eIF3 subunit 6 N terminal domain 2.6E-44 16 151
PF01399 PCI PCI domain 5.7E-11 311 409

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7F3L0|EIF3E_SCLS1 Eukaryotic translation initiation factor 3 subunit E OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|Q7S519|EIF3E_NEUCR Eukaryotic translation initiation factor 3 subunit E OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=int-6 PE=3 SV=1 19 439 0.0E+00
sp|Q0U0X1|EIF3E_PHANO Eukaryotic translation initiation factor 3 subunit E OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INT6 PE=3 SV=3 9 439 0.0E+00
sp|A1CKN7|EIF3E_ASPCL Eukaryotic translation initiation factor 3 subunit E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=int6 PE=3 SV=1 10 433 0.0E+00
sp|Q5B973|EIF3E_EMENI Eukaryotic translation initiation factor 3 subunit E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=int6 PE=3 SV=1 10 438 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7F3L0|EIF3E_SCLS1 Eukaryotic translation initiation factor 3 subunit E OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|Q7S519|EIF3E_NEUCR Eukaryotic translation initiation factor 3 subunit E OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=int-6 PE=3 SV=1 19 439 0.0E+00
sp|Q0U0X1|EIF3E_PHANO Eukaryotic translation initiation factor 3 subunit E OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INT6 PE=3 SV=3 9 439 0.0E+00
sp|A1CKN7|EIF3E_ASPCL Eukaryotic translation initiation factor 3 subunit E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=int6 PE=3 SV=1 10 433 0.0E+00
sp|Q5B973|EIF3E_EMENI Eukaryotic translation initiation factor 3 subunit E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=int6 PE=3 SV=1 10 438 0.0E+00
sp|A1D6T6|EIF3E_NEOFI Eukaryotic translation initiation factor 3 subunit E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=int6 PE=3 SV=1 10 433 0.0E+00
sp|Q2UKS9|EIF3E_ASPOR Eukaryotic translation initiation factor 3 subunit E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|Q0CNR3|EIF3E_ASPTN Eukaryotic translation initiation factor 3 subunit E OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=int6 PE=3 SV=1 10 433 0.0E+00
sp|Q4WY08|EIF3E_ASPFU Eukaryotic translation initiation factor 3 subunit E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|B0XXL3|EIF3E_ASPFC Eukaryotic translation initiation factor 3 subunit E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|Q1E170|EIF3E_COCIM Eukaryotic translation initiation factor 3 subunit E OS=Coccidioides immitis (strain RS) GN=INT6 PE=3 SV=1 2 439 0.0E+00
sp|A4R796|EIF3E_MAGO7 Eukaryotic translation initiation factor 3 subunit E OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INT6 PE=3 SV=1 15 439 0.0E+00
sp|Q2HBQ2|EIF3E_CHAGB Eukaryotic translation initiation factor 3 subunit E OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=INT6 PE=3 SV=1 15 439 0.0E+00
sp|A6SM77|EIF3E_BOTFB Eukaryotic translation initiation factor 3 subunit E OS=Botryotinia fuckeliana (strain B05.10) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|A5AAA4|EIF3E_ASPNC Eukaryotic translation initiation factor 3 subunit E OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=int6 PE=3 SV=1 10 439 0.0E+00
sp|Q6C0Q2|EIF3E_YARLI Eukaryotic translation initiation factor 3 subunit E OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=INT6 PE=3 SV=1 21 438 1.0E-125
sp|Q9C5Z3|EIF3E_ARATH Eukaryotic translation initiation factor 3 subunit E OS=Arabidopsis thaliana GN=TIF3E1 PE=1 SV=1 15 430 2.0E-110
sp|Q3B8M3|EI3EB_XENLA Eukaryotic translation initiation factor 3 subunit E-B OS=Xenopus laevis GN=eif3e-b PE=2 SV=1 19 439 2.0E-108
sp|Q05AY2|EI3EA_XENLA Eukaryotic translation initiation factor 3 subunit E-A OS=Xenopus laevis GN=eif3e-a PE=2 SV=1 19 439 2.0E-108
sp|Q6P7L9|EIF3E_XENTR Eukaryotic translation initiation factor 3 subunit E OS=Xenopus tropicalis GN=eif3e PE=2 SV=1 19 439 1.0E-107
sp|Q1LUA8|EI3EB_DANRE Eukaryotic translation initiation factor 3 subunit E-B OS=Danio rerio GN=eif3eb PE=3 SV=2 19 439 2.0E-107
sp|Q6DRI1|EI3EA_DANRE Eukaryotic translation initiation factor 3 subunit E-A OS=Danio rerio GN=eif3ea PE=2 SV=2 19 439 4.0E-106
sp|B5DGH9|EIF3E_SALSA Eukaryotic translation initiation factor 3 subunit E OS=Salmo salar GN=eif3e PE=2 SV=1 19 439 4.0E-105
sp|Q3T102|EIF3E_BOVIN Eukaryotic translation initiation factor 3 subunit E OS=Bos taurus GN=EIF3E PE=2 SV=1 19 439 1.0E-104
sp|P60228|EIF3E_HUMAN Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens GN=EIF3E PE=1 SV=1 19 439 2.0E-104
sp|Q4R6G8|EIF3E_MACFA Eukaryotic translation initiation factor 3 subunit E OS=Macaca fascicularis GN=EIF3E PE=2 SV=1 19 439 2.0E-104
sp|Q5R8K9|EIF3E_PONAB Eukaryotic translation initiation factor 3 subunit E OS=Pongo abelii GN=EIF3E PE=2 SV=2 19 439 2.0E-104
sp|Q641X8|EIF3E_RAT Eukaryotic translation initiation factor 3 subunit E OS=Rattus norvegicus GN=Eif3e PE=2 SV=1 19 439 2.0E-104
sp|P60229|EIF3E_MOUSE Eukaryotic translation initiation factor 3 subunit E OS=Mus musculus GN=Eif3e PE=1 SV=1 19 439 2.0E-104
sp|Q5ZLA5|EIF3E_CHICK Eukaryotic translation initiation factor 3 subunit E OS=Gallus gallus GN=EIF3E PE=2 SV=1 19 439 3.0E-103
sp|Q4PHN4|EIF3E_USTMA Eukaryotic translation initiation factor 3 subunit E OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INT6 PE=3 SV=1 19 439 2.0E-102
sp|A7RWP6|EIF3E_NEMVE Eukaryotic translation initiation factor 3 subunit E OS=Nematostella vectensis GN=v1g163572 PE=3 SV=1 23 439 6.0E-100
sp|O94513|EIF3E_SCHPO Eukaryotic translation initiation factor 3 subunit E OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=int6 PE=1 SV=1 22 439 1.0E-98
sp|Q2F5R8|EIF3E_BOMMO Eukaryotic translation initiation factor 3 subunit E OS=Bombyx mori GN=eIF3-S6 PE=2 SV=1 19 439 3.0E-93
sp|P0CN50|EIF3E_CRYNJ Eukaryotic translation initiation factor 3 subunit E OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INT6 PE=3 SV=1 19 437 2.0E-91
sp|P0CN51|EIF3E_CRYNB Eukaryotic translation initiation factor 3 subunit E OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INT6 PE=3 SV=1 19 437 2.0E-91
sp|B4N3B0|EI3E2_DROWI Eukaryotic translation initiation factor 3 subunit E-2 OS=Drosophila willistoni GN=eIF3-S6-2 PE=3 SV=1 22 439 3.0E-81
sp|B4KY00|EIF3E_DROMO Eukaryotic translation initiation factor 3 subunit E OS=Drosophila mojavensis GN=eIF3-S6 PE=3 SV=1 22 439 3.0E-81
sp|B3M4D9|EIF3E_DROAN Eukaryotic translation initiation factor 3 subunit E OS=Drosophila ananassae GN=eIF3-S6 PE=3 SV=1 22 439 3.0E-81
sp|B4LG58|EIF3E_DROVI Eukaryotic translation initiation factor 3 subunit E OS=Drosophila virilis GN=eIF3-S6 PE=3 SV=1 22 439 7.0E-81
sp|Q29EX2|EIF3E_DROPS Eukaryotic translation initiation factor 3 subunit E OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S6 PE=3 SV=1 22 439 7.0E-81
sp|B4PK98|EIF3E_DROYA Eukaryotic translation initiation factor 3 subunit E OS=Drosophila yakuba GN=eIF3-S6 PE=3 SV=1 23 439 8.0E-81
sp|B3NDH5|EIF3E_DROER Eukaryotic translation initiation factor 3 subunit E OS=Drosophila erecta GN=eIF3-S6 PE=3 SV=1 23 439 8.0E-81
sp|B4H5N1|EIF3E_DROPE Eukaryotic translation initiation factor 3 subunit E OS=Drosophila persimilis GN=eIF3-S6 PE=3 SV=1 23 439 1.0E-80
sp|B4QMY7|EIF3E_DROSI Eukaryotic translation initiation factor 3 subunit E OS=Drosophila simulans GN=eIF3-S6 PE=3 SV=1 23 439 2.0E-80
sp|O77410|EIF3E_DROME Eukaryotic translation initiation factor 3 subunit E OS=Drosophila melanogaster GN=eIF3-S6 PE=2 SV=1 23 439 2.0E-80
sp|B4IXG1|EIF3E_DROGR Eukaryotic translation initiation factor 3 subunit E OS=Drosophila grimshawi GN=eIF3-S6 PE=3 SV=1 22 439 1.0E-79
sp|B4MYA1|EI3E1_DROWI Eukaryotic translation initiation factor 3 subunit E-1 OS=Drosophila willistoni GN=eIF3-S6-1 PE=3 SV=1 22 433 2.0E-79
sp|B0WAM5|EIF3E_CULQU Eukaryotic translation initiation factor 3 subunit E OS=Culex quinquefasciatus GN=eIF3-S6 PE=3 SV=1 22 439 4.0E-79
sp|B4HK67|EIF3E_DROSE Eukaryotic translation initiation factor 3 subunit E OS=Drosophila sechellia GN=eIF3-S6 PE=3 SV=2 23 439 8.0E-79
sp|Q1HQY6|EIF3E_AEDAE Eukaryotic translation initiation factor 3 subunit E OS=Aedes aegypti GN=eIF3-S6 PE=2 SV=1 22 439 2.0E-78
sp|A8NY27|EIF3E_BRUMA Eukaryotic translation initiation factor 3 subunit E OS=Brugia malayi GN=Bm1_11985 PE=3 SV=2 19 439 4.0E-77
sp|Q7QIL8|EIF3E_ANOGA Eukaryotic translation initiation factor 3 subunit E OS=Anopheles gambiae GN=eIF3-S6 PE=3 SV=2 22 439 6.0E-75
sp|O61820|EIF3E_CAEEL Eukaryotic translation initiation factor 3 subunit E OS=Caenorhabditis elegans GN=eif-3.E PE=3 SV=1 19 439 3.0E-74
sp|A8XFH3|EIF3E_CAEBR Eukaryotic translation initiation factor 3 subunit E OS=Caenorhabditis briggsae GN=eif-3.E PE=3 SV=2 137 439 6.0E-64
sp|Q54CC5|EIF3E_DICDI Eukaryotic translation initiation factor 3 subunit E OS=Dictyostelium discoideum GN=eif3E PE=3 SV=1 136 429 4.0E-61
sp|A9UQS1|EIF3E_MONBE Eukaryotic translation initiation factor 3 subunit E OS=Monosiga brevicollis GN=13685 PE=3 SV=1 89 433 9.0E-51
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4191
MEEVLKTMAADGSSIMPLLAPHLSRHLLFPLIQFEGDKAEEKGDDEWARKILPGKIQLLEETNMTDYVATLYCDL
HGVAEPPAEYTKKRQEVLAQLEKYEQATAKIADLLTQDDVVNGLRSDKVANLEFLKNQHGVTMDMVNALYDFGQF
QFRCGQYGPAADMLYQFRVLSTDNDKVSASTWGKLASEILSANWESAVDELKNVREGIDTKLFSNPRAQLDHRTM
LVHWALFPLFNWEGAREPILDLFFSAAYINTIQTSCPWILRYLIAAVITGRTRARNSSTQQKQLKDIVRYVRQEA
YEYADPVTRFIHALYIAHDFDAARDALRSADAVCRADFFLASSADAFVGAARHLICESYCKIFSRMNMRDLSAKL
GLDPDDGEKWIVNLIRETRLDAKIDSKDGTVVMNHPPNNVYQQVIEKTKGGFFRTQVLNAAVSK*
Coding >Hirsu2|4191
ATGGAGGAGGTTCTGAAGACGATGGCGGCCGACGGCTCGTCCATCATGCCGCTGCTGGCGCCGCACCTGAGCCGG
CACCTTCTCTTCCCGCTGATCCAGTTCGAGGGCGACAAGGCGGAGGAGAAGGGCGACGACGAGTGGGCGAGGAAG
ATCCTGCCCGGCAAGATCCAGCTGCTGGAGGAGACGAACATGACCGACTACGTGGCGACGCTGTACTGCGACCTG
CACGGCGTGGCCGAGCCGCCGGCCGAGTACACGAAGAAGAGGCAGGAGGTGCTGGCGCAGCTGGAGAAGTACGAG
CAGGCGACGGCCAAGATTGCCGACCTGCTGACGCAGGACGACGTCGTCAACGGCCTGCGGAGCGACAAGGTCGCC
AACCTGGAGTTTCTGAAGAACCAGCACGGGGTGACGATGGACATGGTCAACGCGCTCTACGACTTCGGGCAGTTC
CAGTTCCGGTGCGGGCAGTACGGCCCGGCGGCGGACATGCTGTACCAGTTCCGGGTGCTGTCGACGGACAACGAC
AAGGTGTCGGCGTCGACGTGGGGCAAGCTGGCGTCGGAGATCTTGTCGGCCAACTGGGAGTCGGCGGTGGACGAG
CTGAAGAACGTGCGGGAGGGCATCGACACGAAGCTGTTCAGCAACCCGCGGGCGCAGCTGGACCACCGCACCATG
CTCGTCCACTGGGCGCTCTTCCCCCTCTTCAACTGGGAGGGGGCGCGCGAGCCGATCCTGGACCTGTTCTTCTCG
GCGGCCTACATCAACACGATCCAGACGTCGTGCCCGTGGATCCTGCGGTACCTGATCGCGGCCGTCATCACGGGC
CGGACGCGGGCGCGCAACAGCTCGACGCAGCAGAAGCAGCTCAAGGACATTGTGCGGTACGTGCGGCAGGAGGCG
TACGAGTACGCCGACCCCGTCACCCGCTTCATCCACGCGCTCTACATCGCGCACGACTTCGACGCCGCGCGCGAC
GCCCTGCGCTCCGCCGACGCCGTCTGCCGCGCCGACTTCTTCCTCGCCTCGTCGGCCGACGCCTTCGTCGGCGCC
GCCCGCCACCTCATCTGCGAGAGCTACTGCAAGATCTTCAGCCGGATGAACATGCGCGACCTCAGCGCCAAGCTC
GGCCTCGACCCGGACGACGGCGAGAAGTGGATCGTCAACCTGATCCGCGAGACGCGCCTCGACGCAAAGATCGAC
AGCAAGGACGGCACCGTCGTCATGAACCACCCGCCCAACAACGTCTACCAGCAGGTCATCGAGAAGACAAAGGGC
GGCTTCTTCCGCACCCAGGTCCTCAACGCCGCCGTCTCCAAGTAG
Transcript >Hirsu2|4191
ATGGAGGAGGTTCTGAAGACGATGGCGGCCGACGGCTCGTCCATCATGCCGCTGCTGGCGCCGCACCTGAGCCGG
CACCTTCTCTTCCCGCTGATCCAGTTCGAGGGCGACAAGGCGGAGGAGAAGGGCGACGACGAGTGGGCGAGGAAG
ATCCTGCCCGGCAAGATCCAGCTGCTGGAGGAGACGAACATGACCGACTACGTGGCGACGCTGTACTGCGACCTG
CACGGCGTGGCCGAGCCGCCGGCCGAGTACACGAAGAAGAGGCAGGAGGTGCTGGCGCAGCTGGAGAAGTACGAG
CAGGCGACGGCCAAGATTGCCGACCTGCTGACGCAGGACGACGTCGTCAACGGCCTGCGGAGCGACAAGGTCGCC
AACCTGGAGTTTCTGAAGAACCAGCACGGGGTGACGATGGACATGGTCAACGCGCTCTACGACTTCGGGCAGTTC
CAGTTCCGGTGCGGGCAGTACGGCCCGGCGGCGGACATGCTGTACCAGTTCCGGGTGCTGTCGACGGACAACGAC
AAGGTGTCGGCGTCGACGTGGGGCAAGCTGGCGTCGGAGATCTTGTCGGCCAACTGGGAGTCGGCGGTGGACGAG
CTGAAGAACGTGCGGGAGGGCATCGACACGAAGCTGTTCAGCAACCCGCGGGCGCAGCTGGACCACCGCACCATG
CTCGTCCACTGGGCGCTCTTCCCCCTCTTCAACTGGGAGGGGGCGCGCGAGCCGATCCTGGACCTGTTCTTCTCG
GCGGCCTACATCAACACGATCCAGACGTCGTGCCCGTGGATCCTGCGGTACCTGATCGCGGCCGTCATCACGGGC
CGGACGCGGGCGCGCAACAGCTCGACGCAGCAGAAGCAGCTCAAGGACATTGTGCGGTACGTGCGGCAGGAGGCG
TACGAGTACGCCGACCCCGTCACCCGCTTCATCCACGCGCTCTACATCGCGCACGACTTCGACGCCGCGCGCGAC
GCCCTGCGCTCCGCCGACGCCGTCTGCCGCGCCGACTTCTTCCTCGCCTCGTCGGCCGACGCCTTCGTCGGCGCC
GCCCGCCACCTCATCTGCGAGAGCTACTGCAAGATCTTCAGCCGGATGAACATGCGCGACCTCAGCGCCAAGCTC
GGCCTCGACCCGGACGACGGCGAGAAGTGGATCGTCAACCTGATCCGCGAGACGCGCCTCGACGCAAAGATCGAC
AGCAAGGACGGCACCGTCGTCATGAACCACCCGCCCAACAACGTCTACCAGCAGGTCATCGAGAAGACAAAGGGC
GGCTTCTTCCGCACCCAGGTCCTCAACGCCGCCGTCTCCAAGTAG
Gene >Hirsu2|4191
ATGGAGGAGGTTCTGAAGACGATGGCGGCCGACGGCTCGTCCATCATGCCGCTGCTGGCGCCGCACCTGAGCCGG
CACCTTCTCTTCCCGCTGATCCAGTTCGAGGGCGACAAGGCGGAGGAGAAGGGCGACGACGAGTGGGCGAGGAAG
ATCCTGCCCGGCAAGATCCAGCTGCTGGAGGAGACGAACATGACCGACTACGTGGCGACGCTGTACTGCGACCTG
CACGGCGTGGCCGAGCCGCCGGCCGAGTACACGAAGAAGAGGCAGGAGGTGCTGGCGCAGCTGGAGAAGTACGAG
CAGGCGACGGCCAAGATTGCCGACCTGCTGACGCAGGACGACGTCGTCAACGGCCTGCGGAGCGACAAGGTCGCC
AACCTGGAGTTTCTGAAGAACCAGCACGGGGTGAGCAGTCCCTGGTCAAGGCATGCACGGGAGAGGAGAGGAGCT
GACTGAGGCGTCGGACAAACAGGTGACGATGGACATGGTCAACGCGCTCTACGACTTCGGGCAGTTCCAGTTCCG
GTGCGGGCAGTACGGCCCGGCGGCGGACATGCTGTACCAGTTCCGGGTGCTGTCGACGGACAACGACAAGGTGTC
GGCGTCGACGTGGGGCAAGCTGGCGTCGGAGATCTTGTCGGCCAACTGGGAGTCGGCGGTGGACGAGCTGAAGAA
CGTGCGGGAGGGCATCGACACGAAGCTGTTCAGCAACCCGCGGGCGCAGCTGGACCACCGCACCATGCTCGTCCA
CTGGGCGCTCTTCCCCCTCTTCAACTGGGAGGGGGCGCGCGAGCCGATCCTGGACCTGTTCTTCTCGGCGGCCTA
CATCAACACGATCCAGACGTCGTGCCCGTGGATCCTGCGGTACCTGATCGCGGCCGTCATCACGGGCCGGACGCG
GGCGCGCAACAGCTCGACGCAGCAGAAGCAGCTCAAGGACATTGTGCGGTACGTGCGGCAGGAGGCGTACGAGTA
CGCCGACCCCGTCACCCGCTTCATCCACGCGCTCTACATCGCGCACGACTTCGACGCCGCGCGCGACGCCCTGCG
CTCCGCCGACGCCGTCTGCCGCGCCGACTTCTTCCTCGCCTCGTCGGCCGACGCCTTCGTCGGCGCCGCCCGCCA
CCTCATCTGCGAGAGCTACTGCAAGATCTTCAGCCGGATGAACATGCGCGACCTCAGCGCCAAGCTCGGCCTCGA
CCCGGACGACGGCGAGAAGTGGATCGTCAACCTGATCCGCGAGACGCGCCTCGACGCAAAGATCGACAGCAAGGA
CGGCACCGTCGTCATGAACCACCCGCCCAACAACGTCTACCAGCAGGTCATCGAGAAGACAAAGGGCGGCTTCTT
CCGCACCCAGGTCCTCAACGCCGCCGTCTCCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail