Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|419
Gene name
LocationContig_1083:5823..9212
Strand-
Gene length (bp)3389
Transcript length (bp)3333
Coding sequence length (bp)3333
Protein length (aa) 1111

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B 3.5E-74 353 625
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 7.0E-50 4 184
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 1.2E-31 215 321
PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D 4.3E-23 692 912
PF00364 Biotin_lipoyl Biotin-requiring enzyme 4.0E-10 1041 1103
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 1.0E-08 6 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 1 1098 0.0E+00
sp|P38095|LAMA_EMENI Putative urea carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamA PE=2 SV=2 1 1106 0.0E+00
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 1 1098 0.0E+00
sp|O34544|ACCC2_BACSU Biotin carboxylase 2 OS=Bacillus subtilis (strain 168) GN=accC2 PE=3 SV=1 2 320 2.0E-68
sp|P9WPQ3|BCCA_MYCTU Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accA1 PE=1 SV=1 4 367 2.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 1 1098 0.0E+00
sp|P38095|LAMA_EMENI Putative urea carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamA PE=2 SV=2 1 1106 0.0E+00
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 1 1098 0.0E+00
sp|O34544|ACCC2_BACSU Biotin carboxylase 2 OS=Bacillus subtilis (strain 168) GN=accC2 PE=3 SV=1 2 320 2.0E-68
sp|P9WPQ3|BCCA_MYCTU Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accA1 PE=1 SV=1 4 367 2.0E-68
sp|P9WPQ2|BCCA_MYCTO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accA1 PE=3 SV=1 4 367 2.0E-68
sp|P0A509|BCCA_MYCBO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accA1 PE=3 SV=1 4 367 2.0E-68
sp|Q9KDS9|ACCC_BACHD Biotin carboxylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=accC PE=3 SV=1 2 322 5.0E-67
sp|O27939|PYCA_METTH Pyruvate carboxylase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycA PE=1 SV=1 2 324 3.0E-64
sp|Q06862|ACCC_NOSS1 Biotin carboxylase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=accC PE=3 SV=1 1 323 9.0E-64
sp|Q96RQ3|MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens GN=MCCC1 PE=1 SV=3 4 320 2.0E-63
sp|Q5I0C3|MCCA_RAT Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Mccc1 PE=1 SV=1 4 320 3.0E-63
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 6 324 2.0E-60
sp|Q2QMG2|MCCA_ORYSJ Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=MCCA PE=2 SV=2 12 344 3.0E-60
sp|P49787|ACCC1_BACSU Biotin carboxylase 1 OS=Bacillus subtilis (strain 168) GN=accC1 PE=3 SV=3 1 323 4.0E-60
sp|Q99MR8|MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus GN=Mccc1 PE=1 SV=2 4 320 4.0E-60
sp|O04983|ACCC_ARATH Biotin carboxylase, chloroplastic OS=Arabidopsis thaliana GN=CAC2 PE=1 SV=1 1 320 3.0E-59
sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 12 324 4.0E-59
sp|Q58626|PYCA_METJA Pyruvate carboxylase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycA PE=1 SV=1 6 322 4.0E-59
sp|B9HBA8|ACCC1_POPTR Biotin carboxylase 1, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_831870 PE=2 SV=1 1 320 4.0E-59
sp|Q91ZA3|PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus GN=Pcca PE=1 SV=2 1 327 7.0E-59
sp|B9N843|ACCC2_POPTR Biotin carboxylase 2, chloroplastic OS=Populus trichocarpa GN=POPTR_0018s14250g PE=2 SV=2 1 320 2.0E-58
sp|Q612F5|PCCA_CAEBR Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis briggsae GN=pcca-1 PE=3 SV=1 5 320 4.0E-58
sp|Q54KE6|MCCA_DICDI Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=mccA PE=3 SV=1 12 324 7.0E-58
sp|P05165|PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens GN=PCCA PE=1 SV=4 1 326 1.0E-57
sp|Q19842|PCCA_CAEEL Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans GN=pcca-1 PE=1 SV=1 2 320 3.0E-57
sp|P14882|PCCA_RAT Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus GN=Pcca PE=1 SV=3 6 326 5.0E-55
sp|P37798|ACCC_PSEAE Biotin carboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=accC PE=1 SV=1 5 322 7.0E-55
sp|O30019|PYCA_ARCFU Pyruvate carboxylase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pycA PE=3 SV=1 2 321 3.0E-54
sp|D3DJ42|2OCS_HYDTT 2-oxoglutarate carboxylase small subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiB PE=1 SV=1 6 321 6.0E-53
sp|O52058|ACCC_ALLVD Biotin carboxylase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=accC PE=3 SV=2 10 323 7.0E-50
sp|P43873|ACCC_HAEIN Biotin carboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=accC PE=1 SV=1 10 322 3.0E-49
sp|Q9KWU4|PYC_BACSU Pyruvate carboxylase OS=Bacillus subtilis (strain 168) GN=pyc PE=3 SV=1 16 322 5.0E-49
sp|P24182|ACCC_ECOLI Biotin carboxylase OS=Escherichia coli (strain K12) GN=accC PE=1 SV=2 12 322 1.0E-48
sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 2 321 3.0E-48
sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 2 321 4.0E-48
sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 2 321 4.0E-48
sp|Q8X9B6|ACCC_ECO57 Biotin carboxylase OS=Escherichia coli O157:H7 GN=accC PE=3 SV=1 12 322 4.0E-48
sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 2 321 6.0E-48
sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 2 321 2.0E-47
sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 16 321 2.0E-46
sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 16 321 7.0E-45
sp|Q0CLK1|PYC_ASPTN Pyruvate carboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pyc PE=3 SV=2 16 321 8.0E-45
sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 8 321 1.0E-42
sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 14 321 3.0E-42
sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 2 321 1.0E-41
sp|P11154|PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC1 PE=1 SV=2 2 321 2.0E-40
sp|P46392|BCCA_MYCLE Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium leprae (strain TN) GN=bccA PE=3 SV=2 2 327 2.0E-40
sp|P78992|PYC_PICPA Pyruvate carboxylase OS=Komagataella pastoris GN=PYC1 PE=3 SV=1 5 321 4.0E-40
sp|Q13085|ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens GN=ACACA PE=1 SV=2 2 321 1.0E-36
sp|Q5SWU9|ACACA_MOUSE Acetyl-CoA carboxylase 1 OS=Mus musculus GN=Acaca PE=1 SV=1 2 321 3.0E-36
sp|P11497|ACACA_RAT Acetyl-CoA carboxylase 1 OS=Rattus norvegicus GN=Acaca PE=1 SV=1 2 321 3.0E-36
sp|Q28559|ACACA_SHEEP Acetyl-CoA carboxylase 1 OS=Ovis aries GN=ACACA PE=2 SV=1 2 321 5.0E-36
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 3 323 5.0E-36
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 3 323 6.0E-36
sp|Q9TTS3|ACACA_BOVIN Acetyl-CoA carboxylase 1 OS=Bos taurus GN=ACACA PE=2 SV=1 2 321 7.0E-36
sp|B3LM95|HFA1_YEAS1 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HFA1 PE=3 SV=2 3 323 8.0E-36
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 3 323 1.0E-35
sp|C8ZF72|HFA1_YEAS8 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HFA1 PE=3 SV=2 3 323 1.0E-35
sp|P11029|ACAC_CHICK Acetyl-CoA carboxylase OS=Gallus gallus GN=ACAC PE=1 SV=1 2 321 2.0E-35
sp|Q00955|ACAC_YEAST Acetyl-CoA carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACC1 PE=1 SV=2 12 326 2.0E-35
sp|Q54J08|ACAC_DICDI Acetyl-CoA carboxylase OS=Dictyostelium discoideum GN=accA PE=3 SV=1 2 323 2.0E-34
sp|E9Q4Z2|ACACB_MOUSE Acetyl-CoA carboxylase 2 OS=Mus musculus GN=Acacb PE=1 SV=1 2 335 5.0E-34
sp|P78820|ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut6 PE=1 SV=2 2 321 5.0E-34
sp|O00763|ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens GN=ACACB PE=1 SV=3 2 321 1.0E-33
sp|B9FK36|ACC2_ORYSJ Acetyl-CoA carboxylase 2 OS=Oryza sativa subsp. japonica GN=ACC2 PE=3 SV=2 2 322 2.0E-32
sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana GN=ACC1 PE=1 SV=1 4 322 2.0E-32
sp|Q8S6N5|ACC1_ORYSJ Acetyl-CoA carboxylase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=3 SV=1 2 322 3.0E-31
sp|F4I1L3|ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana GN=ACC2 PE=2 SV=1 4 322 2.0E-30
sp|P75745|YBGK_ECOLI Uncharacterized protein YbgK OS=Escherichia coli (strain K12) GN=ybgK PE=4 SV=1 330 647 1.0E-26
sp|P44298|Y1730_HAEIN Uncharacterized protein HI_1730 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1730 PE=4 SV=1 330 646 7.0E-26
sp|Q7WY77|KIPA_BACSU KipI antagonist OS=Bacillus subtilis (strain 168) GN=kipA PE=2 SV=2 330 646 3.0E-18
sp|P60495|KIPI_BACSU Kinase A inhibitor OS=Bacillus subtilis (strain 168) GN=kipI PE=1 SV=1 697 950 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0005524 ATP binding Yes
GO:0032553 ribonucleotide binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:0016874 ligase activity No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0016881 acid-amino acid ligase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|419
LVGSEDAAADAAAELGYPVMIKATAGGGGMGLLLCRDEAELRANFGTARSRGVSLFRDAGLLLERHIAECHHIEV
QVFGDGRGKAVSLGERECSIQRRYQKVVEECPSPYVAGRRPGLRTELTACAVRLAESIAYGSAGTVEFLVDDHTG
RFFFLEMNTRLQVEHGVTELCYGVDLVELMLRQADRQLRGTGGIDPEELDELQRRCVEPRGHAIEARVYAENPAK
NFAPSPGLLQEVSWYAPHGSRIDSWVRAGVTVSPDYDPLLAKVMYHGPTRQDAVRGLQEVLRRSSVCGPPINLEW
LRAVVLHPAFVDGETTTKFLDSFRFHTPGIDILSGGSYTLVQDHPGRPTVGHGFGHAGPMDPIAFRTANILAGNP
AGTEGLEITLTGPDMVFLGDAVVALCGPPVPAHVDGRHFALWTRAAVRAGQRLTIGKLPAHCRVYLAVFGGFANV
ARWFGSKSTNPMVNVGGYQGRPLRAGDFLRIVDSSELPRGEISPMPQRLLPVYTSDWDIQVMSGPYETGYLSAGD
SDMLYRQTWEVSHNSARGGIRLLGPRPEFGRQDGGDGGSHPSNVIEYGYPIGGINWTGDEPVIFPVDSPDFGGFL
CSHTVVKADMWKMGQLRAGDRVRLRRVALQEALDQRRRHEEFLESLAAAVASGGRWDEAVPFDGQRLGGEISGSD
PDLVTTLEATPSRPAVSYRAGGDDYLLVEYGDGRFDLNHKCRATALQRLINDASGPVSPRKEAGDGAILNMVGCG
NSLAIFYDGLKLPRESLLSRLAGMEETLGDLRSIKLPIRRFRLPVTFAHEKLVEAVERYRLNQRSTASYLPDPFR
FVAECNGLAAEELKELVLSLESVVIGVGFFMALPLCLPVDPRHRLRSPKMNPSRTFTPEGTLGWGGSSVAIYPVE
CPGGYMPMGMTMPGLDLSGTKAGFGADRPWMFESMDVLTFYEVSEDAYDAKMAQFRAGSYGFEVQPGVFDMAAHN
RLLRETAEEAQGLQQQRAVAQKAMALREKEMLKTWLAEKDAGRSQFDCASALAQDERLEAVEAPMNANVWKVLIE
EGQRVEGGQLLAILEAMKMEVNVLVDSKLAGATVAKLLIEPGDGVESGKPMMLMHKAGNE*
Coding >Hirsu2|419
CTGGTCGGCTCCGAGGACGCCGCCGCCGACGCCGCCGCCGAGCTCGGCTACCCCGTCATGATCAAGGCCACGGCC
GGCGGTGGGGGCATGGGGCTGCTGTTGTGTCGCGACGAGGCCGAGCTGCGGGCCAACTTTGGCACGGCACGCTCC
CGCGGCGTCAGCCTGTTCCGGGACGCGGGCCTCTTGCTGGAGCGCCACATCGCGGAATGCCACCACATCGAGGTC
CAAGTCTTCGGCGACGGCCGGGGCAAAGCCGTAAGCCTGGGCGAGCGCGAGTGCTCGATCCAGCGGCGATACCAA
AAGGTGGTCGAGGAGTGCCCGAGTCCCTACGTCGCGGGGCGGCGGCCCGGGCTGCGGACGGAGCTGACGGCCTGC
GCCGTCCGACTCGCCGAGAGCATCGCCTACGGCTCGGCCGGCACCGTCGAGTTCCTGGTCGATGACCACACCGGC
CGCTTCTTCTTCCTCGAGATGAACACCCGGCTCCAGGTCGAGCACGGGGTGACGGAGCTGTGCTACGGCGTCGAC
CTCGTCGAGCTCATGTTGCGGCAGGCCGATCGCCAGCTCCGGGGAACGGGAGGCATCGACCCGGAAGAGCTCGAT
GAACTGCAGCGCCGCTGCGTCGAGCCGCGAGGCCACGCCATAGAGGCGCGAGTCTATGCGGAAAACCCGGCAAAG
AACTTCGCGCCCAGCCCCGGCCTTCTCCAGGAGGTCTCGTGGTACGCGCCGCACGGCTCCCGGATCGATTCGTGG
GTCCGTGCCGGCGTGACGGTCAGTCCCGACTACGACCCCTTGCTGGCCAAGGTCATGTATCACGGTCCGACCCGA
CAGGACGCGGTTCGCGGCCTGCAGGAGGTCCTCCGCCGCAGCTCCGTCTGCGGGCCCCCCATCAACCTGGAGTGG
CTGCGTGCCGTCGTCCTGCATCCCGCCTTCGTCGACGGCGAGACGACGACCAAGTTCCTCGACTCGTTCCGCTTC
CACACGCCCGGCATCGACATCCTCTCGGGCGGCTCGTACACGCTTGTCCAGGACCATCCCGGAAGACCGACCGTC
GGCCACGGGTTTGGGCACGCCGGGCCCATGGACCCGATTGCCTTCCGCACCGCCAACATTCTCGCGGGGAACCCG
GCCGGCACCGAGGGCCTCGAAATCACCCTGACCGGGCCCGACATGGTGTTCCTGGGCGATGCCGTCGTTGCCTTG
TGCGGGCCGCCCGTCCCCGCCCACGTCGACGGCCGCCACTTCGCCCTCTGGACACGCGCCGCCGTGCGCGCGGGC
CAGAGACTCACAATCGGGAAGCTTCCTGCTCACTGTCGAGTCTATCTGGCCGTCTTCGGTGGCTTCGCCAACGTG
GCCCGCTGGTTCGGAAGCAAGTCCACCAACCCCATGGTGAACGTGGGCGGCTACCAGGGCCGTCCCCTACGAGCT
GGCGACTTTCTCCGAATAGTGGACTCGTCCGAGCTGCCAAGAGGAGAGATATCGCCCATGCCGCAGCGCCTCCTT
CCCGTATACACCTCTGACTGGGACATCCAAGTCATGTCTGGTCCCTACGAGACTGGATATCTCTCGGCCGGGGAC
AGCGACATGCTGTACCGACAGACGTGGGAGGTAAGCCACAACTCGGCCAGGGGAGGCATCCGCCTGCTCGGCCCC
AGACCCGAGTTCGGGCGACAGGACGGGGGAGACGGCGGCTCCCACCCGAGCAACGTGATCGAGTACGGCTACCCG
ATCGGCGGCATCAACTGGACGGGGGACGAGCCGGTCATCTTCCCCGTCGACAGCCCCGACTTCGGCGGCTTCCTC
TGCAGCCACACGGTCGTCAAGGCGGACATGTGGAAGATGGGCCAGCTCCGCGCGGGCGACCGTGTCCGGCTCCGG
AGAGTGGCGCTCCAGGAGGCGCTGGACCAACGGCGGAGGCACGAGGAGTTCCTCGAGAGCCTCGCCGCTGCTGTT
GCCAGCGGCGGCCGCTGGGACGAGGCCGTTCCCTTTGACGGCCAGAGGCTGGGGGGCGAGATCTCCGGCTCGGAC
CCGGACCTGGTCACGACGCTGGAGGCAACGCCGTCGAGACCGGCCGTTTCGTACCGTGCTGGCGGCGACGACTAC
CTGCTCGTAGAGTACGGAGACGGCCGGTTCGACCTGAACCACAAGTGCAGAGCGACGGCGCTGCAACGCCTCATC
AACGACGCCTCCGGCCCCGTCTCGCCCCGGAAGGAGGCGGGAGACGGAGCCATCCTCAACATGGTCGGCTGCGGA
AACTCGCTAGCCATCTTCTACGACGGCCTGAAGCTGCCGCGCGAGAGCCTTTTGAGCCGCCTGGCCGGGATGGAG
GAGACGTTGGGAGACCTGCGGTCGATCAAACTGCCCATCCGCCGATTCCGCCTGCCGGTGACGTTTGCGCACGAG
AAGCTCGTCGAGGCCGTCGAGCGGTACAGGTTGAATCAGCGCTCGACGGCGAGCTACCTGCCGGACCCCTTCCGA
TTCGTGGCGGAATGCAACGGCCTGGCGGCGGAGGAGCTCAAGGAGCTCGTGCTCAGCCTCGAGTCGGTCGTCATC
GGCGTCGGCTTCTTCATGGCCCTCCCGCTCTGCCTGCCGGTCGACCCGCGCCACCGGCTACGGTCGCCCAAGATG
AACCCGAGCCGGACGTTCACGCCCGAGGGAACCTTGGGATGGGGAGGGAGTTCGGTCGCCATCTACCCCGTCGAA
TGCCCCGGGGGATACATGCCGATGGGCATGACGATGCCAGGCCTCGACTTGTCTGGCACCAAGGCGGGCTTCGGC
GCGGATCGGCCGTGGATGTTCGAGAGCATGGACGTGCTGACCTTTTACGAAGTGAGCGAGGACGCGTACGACGCG
AAGATGGCCCAGTTCAGGGCCGGGAGCTACGGCTTCGAGGTGCAGCCCGGCGTTTTCGACATGGCCGCCCACAAC
CGGCTGCTCCGGGAGACGGCCGAGGAGGCGCAAGGTCTGCAGCAGCAGAGAGCGGTGGCGCAGAAGGCGATGGCC
CTGCGCGAGAAGGAGATGCTGAAGACGTGGCTGGCCGAGAAGGATGCCGGCCGCTCCCAGTTTGACTGCGCCTCG
GCCCTCGCCCAAGATGAGAGGCTCGAAGCGGTCGAGGCGCCCATGAACGCCAATGTGTGGAAAGTCCTGATCGAG
GAGGGCCAGCGGGTGGAGGGCGGTCAGTTGCTGGCGATCCTGGAGGCCATGAAGATGGAAGTCAACGTGCTCGTG
GACAGCAAGCTGGCCGGGGCGACGGTGGCCAAGCTGTTGATCGAGCCCGGCGATGGCGTGGAGAGCGGCAAGCCA
ATGATGCTGATGCACAAGGCAGGCAATGAGTGA
Transcript >Hirsu2|419
CTGGTCGGCTCCGAGGACGCCGCCGCCGACGCCGCCGCCGAGCTCGGCTACCCCGTCATGATCAAGGCCACGGCC
GGCGGTGGGGGCATGGGGCTGCTGTTGTGTCGCGACGAGGCCGAGCTGCGGGCCAACTTTGGCACGGCACGCTCC
CGCGGCGTCAGCCTGTTCCGGGACGCGGGCCTCTTGCTGGAGCGCCACATCGCGGAATGCCACCACATCGAGGTC
CAAGTCTTCGGCGACGGCCGGGGCAAAGCCGTAAGCCTGGGCGAGCGCGAGTGCTCGATCCAGCGGCGATACCAA
AAGGTGGTCGAGGAGTGCCCGAGTCCCTACGTCGCGGGGCGGCGGCCCGGGCTGCGGACGGAGCTGACGGCCTGC
GCCGTCCGACTCGCCGAGAGCATCGCCTACGGCTCGGCCGGCACCGTCGAGTTCCTGGTCGATGACCACACCGGC
CGCTTCTTCTTCCTCGAGATGAACACCCGGCTCCAGGTCGAGCACGGGGTGACGGAGCTGTGCTACGGCGTCGAC
CTCGTCGAGCTCATGTTGCGGCAGGCCGATCGCCAGCTCCGGGGAACGGGAGGCATCGACCCGGAAGAGCTCGAT
GAACTGCAGCGCCGCTGCGTCGAGCCGCGAGGCCACGCCATAGAGGCGCGAGTCTATGCGGAAAACCCGGCAAAG
AACTTCGCGCCCAGCCCCGGCCTTCTCCAGGAGGTCTCGTGGTACGCGCCGCACGGCTCCCGGATCGATTCGTGG
GTCCGTGCCGGCGTGACGGTCAGTCCCGACTACGACCCCTTGCTGGCCAAGGTCATGTATCACGGTCCGACCCGA
CAGGACGCGGTTCGCGGCCTGCAGGAGGTCCTCCGCCGCAGCTCCGTCTGCGGGCCCCCCATCAACCTGGAGTGG
CTGCGTGCCGTCGTCCTGCATCCCGCCTTCGTCGACGGCGAGACGACGACCAAGTTCCTCGACTCGTTCCGCTTC
CACACGCCCGGCATCGACATCCTCTCGGGCGGCTCGTACACGCTTGTCCAGGACCATCCCGGAAGACCGACCGTC
GGCCACGGGTTTGGGCACGCCGGGCCCATGGACCCGATTGCCTTCCGCACCGCCAACATTCTCGCGGGGAACCCG
GCCGGCACCGAGGGCCTCGAAATCACCCTGACCGGGCCCGACATGGTGTTCCTGGGCGATGCCGTCGTTGCCTTG
TGCGGGCCGCCCGTCCCCGCCCACGTCGACGGCCGCCACTTCGCCCTCTGGACACGCGCCGCCGTGCGCGCGGGC
CAGAGACTCACAATCGGGAAGCTTCCTGCTCACTGTCGAGTCTATCTGGCCGTCTTCGGTGGCTTCGCCAACGTG
GCCCGCTGGTTCGGAAGCAAGTCCACCAACCCCATGGTGAACGTGGGCGGCTACCAGGGCCGTCCCCTACGAGCT
GGCGACTTTCTCCGAATAGTGGACTCGTCCGAGCTGCCAAGAGGAGAGATATCGCCCATGCCGCAGCGCCTCCTT
CCCGTATACACCTCTGACTGGGACATCCAAGTCATGTCTGGTCCCTACGAGACTGGATATCTCTCGGCCGGGGAC
AGCGACATGCTGTACCGACAGACGTGGGAGGTAAGCCACAACTCGGCCAGGGGAGGCATCCGCCTGCTCGGCCCC
AGACCCGAGTTCGGGCGACAGGACGGGGGAGACGGCGGCTCCCACCCGAGCAACGTGATCGAGTACGGCTACCCG
ATCGGCGGCATCAACTGGACGGGGGACGAGCCGGTCATCTTCCCCGTCGACAGCCCCGACTTCGGCGGCTTCCTC
TGCAGCCACACGGTCGTCAAGGCGGACATGTGGAAGATGGGCCAGCTCCGCGCGGGCGACCGTGTCCGGCTCCGG
AGAGTGGCGCTCCAGGAGGCGCTGGACCAACGGCGGAGGCACGAGGAGTTCCTCGAGAGCCTCGCCGCTGCTGTT
GCCAGCGGCGGCCGCTGGGACGAGGCCGTTCCCTTTGACGGCCAGAGGCTGGGGGGCGAGATCTCCGGCTCGGAC
CCGGACCTGGTCACGACGCTGGAGGCAACGCCGTCGAGACCGGCCGTTTCGTACCGTGCTGGCGGCGACGACTAC
CTGCTCGTAGAGTACGGAGACGGCCGGTTCGACCTGAACCACAAGTGCAGAGCGACGGCGCTGCAACGCCTCATC
AACGACGCCTCCGGCCCCGTCTCGCCCCGGAAGGAGGCGGGAGACGGAGCCATCCTCAACATGGTCGGCTGCGGA
AACTCGCTAGCCATCTTCTACGACGGCCTGAAGCTGCCGCGCGAGAGCCTTTTGAGCCGCCTGGCCGGGATGGAG
GAGACGTTGGGAGACCTGCGGTCGATCAAACTGCCCATCCGCCGATTCCGCCTGCCGGTGACGTTTGCGCACGAG
AAGCTCGTCGAGGCCGTCGAGCGGTACAGGTTGAATCAGCGCTCGACGGCGAGCTACCTGCCGGACCCCTTCCGA
TTCGTGGCGGAATGCAACGGCCTGGCGGCGGAGGAGCTCAAGGAGCTCGTGCTCAGCCTCGAGTCGGTCGTCATC
GGCGTCGGCTTCTTCATGGCCCTCCCGCTCTGCCTGCCGGTCGACCCGCGCCACCGGCTACGGTCGCCCAAGATG
AACCCGAGCCGGACGTTCACGCCCGAGGGAACCTTGGGATGGGGAGGGAGTTCGGTCGCCATCTACCCCGTCGAA
TGCCCCGGGGGATACATGCCGATGGGCATGACGATGCCAGGCCTCGACTTGTCTGGCACCAAGGCGGGCTTCGGC
GCGGATCGGCCGTGGATGTTCGAGAGCATGGACGTGCTGACCTTTTACGAAGTGAGCGAGGACGCGTACGACGCG
AAGATGGCCCAGTTCAGGGCCGGGAGCTACGGCTTCGAGGTGCAGCCCGGCGTTTTCGACATGGCCGCCCACAAC
CGGCTGCTCCGGGAGACGGCCGAGGAGGCGCAAGGTCTGCAGCAGCAGAGAGCGGTGGCGCAGAAGGCGATGGCC
CTGCGCGAGAAGGAGATGCTGAAGACGTGGCTGGCCGAGAAGGATGCCGGCCGCTCCCAGTTTGACTGCGCCTCG
GCCCTCGCCCAAGATGAGAGGCTCGAAGCGGTCGAGGCGCCCATGAACGCCAATGTGTGGAAAGTCCTGATCGAG
GAGGGCCAGCGGGTGGAGGGCGGTCAGTTGCTGGCGATCCTGGAGGCCATGAAGATGGAAGTCAACGTGCTCGTG
GACAGCAAGCTGGCCGGGGCGACGGTGGCCAAGCTGTTGATCGAGCCCGGCGATGGCGTGGAGAGCGGCAAGCCA
ATGATGCTGATGCACAAGGCAGGCAATGAGTGA
Gene >Hirsu2|419
CTGGTCGGCTCCGAGGACGCCGCCGCCGACGCCGCCGCCGAGCTCGGCTACCCCGTCATGATCAAGGCCACGGCC
GGCGGTGGGGGCATGGGGCTGCTGTTGTGTCGCGACGAGGCCGAGCTGCGGGCCAACTTTGGCACGGCACGCTCC
CGCGGCGTCAGCCTGTTCCGGGACGCGGGCCTCTTGCTGGAGCGCCACATCGCGGAATGCCACCACATCGAGGTC
CAAGTCTTCGGCGACGGCCGGGGCAAAGCCGTAAGCCTGGGCGAGCGCGAGTGCTCGATCCAGCGGCGATACCAA
AAGGTGGTCGAGGAGTGCCCGAGTCCCTACGTCGCGGGGCGGCGGCCCGGGCTGCGGACGGAGCTGACGGCCTGC
GCCGTCCGACTCGCCGAGAGCATCGCCTACGGCTCGGCCGGCACCGTCGAGTTCCTGGTCGATGACCACACCGGC
CGCTTCTTCTTCCTCGAGATGAACACCCGGCTCCAGGTCGAGCACGGGGTGACGGAGCTGTGCTACGGCGTCGAC
CTCGTCGAGCTCATGTTGCGGCAGGCCGATCGCCAGCTCCGGGGAACGGGAGGCATCGACCCGGAAGAGCTCGAT
GAACTGCAGCGCCGCTGCGTCGAGCCGCGAGGCCACGCCATAGAGGCGCGAGTCTATGCGGAAAACCCGGCAAAG
AACTTCGCGCCCAGCCCCGGCCTTCTCCAGGAGGTCTCGTGGTACGCGCCGCACGGCTCCCGGATCGATTCGTGG
GTCCGTGCCGGCGTGACGGTCAGTCCCGACTACGACCCCTTGCTGGCCAAGGTCATGTATCACGGTCCGACCCGA
CAGGACGCGGTTCGCGGCCTGCAGGAGGTCCTCCGCCGCAGCTCCGTCTGCGGGCCCCCCATCAACCTGGAGTGG
CTGCGTGCCGTCGTCCTGCATCCCGCCTTCGTCGACGGCGAGACGACGACCAAGTTCCTCGACTCGTTCCGCTTC
CACACGCCCGGCATCGACATCCTCTCGGGCGGCTCGTACACGCTTGTCCAGGACCATCCCGGAAGACCGACCGTC
GGCCACGGGTTTGGGCACGCCGGGCCCATGGACCCGATTGCCTTCCGCACCGCCAACATTCTCGCGGGGAACCCG
GCCGGCACCGAGGGCCTCGAAATCACCCTGACCGGGCCCGACATGGTGTTCCTGGGCGATGCCGTCGTTGCCTTG
TGCGGGCCGCCCGTCCCCGCCCACGTCGACGGCCGCCACTTCGCCCTCTGGACACGCGCCGCCGTGCGCGCGGGC
CAGAGACTCACAATCGGGAAGCTTCCTGCTCACTGTCGAGTCTATCTGGCCGTCTTCGGTGGCTTCGCCAACGTG
GCCCGCTGGTTCGGAAGCAAGTCCACCAACCCCATGGTGAACGTGGGCGGCTACCAGGGCCGTCCCCTACGAGCT
GGCGACTTTCTCCGAATAGTGGACTCGTCCGAGCTGCCAAGAGGAGAGATATCGCCCATGCCGCAGCGCCTCCTT
CCCGTATACACCTCTGACTGGGACATCCAAGTCATGTCTGGTCCCTACGAGACTGGATATCTCTCGGCCGGGGAC
AGCGACATGCTGTACCGACAGACGTGGGAGGTAAGCCACAACTCGGCCAGGGGAGGCATCCGCCTGCTCGGCCCC
AGACCCGAGTTCGGGCGACAGGACGGGGGAGACGGCGGCTCCCACCCGAGCAACGTGATCGAGTACGGCTACCCG
ATCGGCGGCATCAACTGGACGGGGGACGAGCCGGTCATCTTCCCCGTCGACAGCCCCGACTTCGGCGGCTTCCTC
TGCAGCCACACGGTCGTCAAGGCGGACATGTGGAAGATGGGCCAGCTCCGCGCGGGCGACCGTGTCCGGCTCCGG
AGAGTGGCGCTCCAGGAGGCGCTGGACCAACGGCGGAGGCACGAGGAGTTCCTCGAGAGCCTCGCCGCTGCTGTT
GCCAGCGGCGGCCGCTGGGACGAGGCCGTTCCCTTTGACGGCCAGAGGCTGGGGGGCGAGATCTCCGGCTCGGAC
CCGGACCTGGTCACGACGCTGGAGGCAACGCCGTCGAGACCGGCCGTTTCGTACCGTGCTGGCGGCGACGACTAC
CTGCTCGTAGAGTACGGAGACGGCCGGTTCGACCTGAACCACAAGTGCAGAGCGACGGCGCTGCAACGCCTCATC
AACGACGCCTCCGGCCCCGTCTCGCCCCGGAAGGAGGCGGGAGACGGAGCCATCCTCAACATGGTCGGCTGCGGA
AACTCGCTAGCCATCTTCTACGACGGCCTGAAGCTGCCGCGCGAGAGCCTTTTGAGCCGCCTGGCCGGGATGGAG
GAGACGTTGGGAGACCTGCGGTCGATCAAACTGCCCATCCGCCGATTCCGCCTGCCGGTGACGTTTGCGCACGAG
AAGCTCGTCGAGGCCGTCGAGCGGTACAGGTTGAATCAGCGCTCGACGGCGAGCTACCTGCCGGACCCCTTCCGA
TTCGTGGCGGAATGCAACGGCCTGGCGGCGGAGGAGCTCAAGGAGCTCGTGCTCAGCCTCGAGTCGGTCGTCATC
GGCGTCGGCTTCTTCATGGCCCTCCCGCTCTGCCTGCCGGTCGACCCGCGCCACCGGCTACGGTCGCCCAAGATG
AACCCGAGCCGGACGTTCACGCCCGAGGGAACCTTGGGATGGGGAGGGAGTTCGGTCGCCATCTACCCCGTCGAA
TGCCCCGGGGGATACATGCCGATGGGCATGACGATGCCAGGCCTCGACTTGTCTGGCACCAAGGCGGGCTTCGGC
GCGGATCGGCCGTGGATGTTCGAGAGCATGGACGTGCTGACCTTTTACGAAGTGAGCGAGGACGCGTACGACGCG
AAGATGGCCCAGTTCAGGGCCGGGAGCTACGGCTTCGAGGTGCAGCCCGGCGTTTTCGACATGGCCGCCCACAAC
CGGCTGCTCCGGGAGACGGCCGAGGAGGCGCAAGGTCTGCAGCAGCAGAGAGCGGTGGCGCAGAAGGCGATGGCC
CTGCGCGAGAAGGAGATGCTGAAGACGTGGCTGGCCGAGAAGGATGCCGGCCGCTCCCAGTTTGACTGCGCCTCG
GCCCTCGCCCAAGGTGAGTCTGTCGCGGCCGTCGTTGTCGCGGCAGTGGTGCTGACGGACGGGCTGCAGATGAGA
GGCTCGAAGCGGTCGAGGCGCCCATGAACGCCAATGTGTGGAAAGTCCTGATCGAGGAGGGCCAGCGGGTGGAGG
GCGGTCAGTTGCTGGCGATCCTGGAGGCCATGAAGATGGAAGTCAACGTGCTCGTGGACAGCAAGCTGGCCGGGG
CGACGGTGGCCAAGCTGTTGATCGAGCCCGGCGATGGCGTGGAGAGCGGCAAGCCAATGATGCTGATGCACAAGG
CAGGCAATGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail