Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4188
Gene name
LocationContig_2157:2453..3506
Strand+
Gene length (bp)1053
Transcript length (bp)789
Coding sequence length (bp)789
Protein length (aa) 263

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-16 64 234
PF00083 Sugar_tr Sugar (and other) transporter 3.8E-08 60 230

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 56 231 1.0E-17
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 55 217 1.0E-15
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 72 225 1.0E-15
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 55 217 3.0E-14
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 55 220 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 56 231 1.0E-17
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 55 217 1.0E-15
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 72 225 1.0E-15
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 55 217 3.0E-14
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 55 220 2.0E-13
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 55 217 2.0E-12
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 53 225 2.0E-12
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 53 225 3.0E-12
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 98 230 3.0E-12
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 15 224 3.0E-12
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 87 208 4.0E-12
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 49 220 6.0E-12
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 20 217 3.0E-11
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 87 208 3.0E-11
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 77 237 4.0E-11
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 48 227 4.0E-11
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 55 262 4.0E-10
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 72 217 5.0E-10
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 40 225 2.0E-09
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 70 217 5.0E-09
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 54 246 5.0E-09
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 56 231 5.0E-08
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 40 255 7.0E-08
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 40 255 7.0E-08
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 82 225 2.0E-07
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 56 225 5.0E-07
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 80 220 5.0E-06
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 49 233 5.0E-06
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 2 220 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0006810 transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Lysosome/Vacuole Signal peptide 0.201 0.3047 0.2095 0.2718 0.2782 0.1313 0.6469 0.7557 0.3818 0.1085

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 99 121 22
3 126 148 22
4 184 206 22
5 219 241 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup31
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|943
Ophiocordyceps australis 1348a (Ghana) OphauG2|6534
Ophiocordyceps australis 1348a (Ghana) OphauG2|6337
Ophiocordyceps australis map64 (Brazil) OphauB2|4705
Ophiocordyceps australis map64 (Brazil) OphauB2|6138
Ophiocordyceps australis map64 (Brazil) OphauB2|4706
Ophiocordyceps australis map64 (Brazil) OphauB2|3523
Ophiocordyceps camponoti-floridani Ophcf2|05803
Ophiocordyceps camponoti-rufipedis Ophun1|4157
Ophiocordyceps camponoti-rufipedis Ophun1|5965
Ophiocordyceps kimflemingae Ophio5|3491
Ophiocordyceps kimflemingae Ophio5|6590
Ophiocordyceps subramaniannii Hirsu2|951
Ophiocordyceps subramaniannii Hirsu2|950
Ophiocordyceps subramaniannii Hirsu2|7425
Ophiocordyceps subramaniannii Hirsu2|4695
Ophiocordyceps subramaniannii Hirsu2|4535
Ophiocordyceps subramaniannii Hirsu2|4188 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2641
Ophiocordyceps subramaniannii Hirsu2|991
Ophiocordyceps subramaniannii Hirsu2|10494

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4188
MVVASRIWPRPEYYDHGAGGPGAGPHRSGSGPARSGSGGGGDDSGCRCPRGEHARKLFVSATVILLNFNVTLASS
LPSGAEPALSAHFGVTSELQRSLPVAVFLAGYIVGPVVVAPLSESLGRRPIFLAAFGLHTAFTLGCALAPGWAAL
RAFRLVLGCAAAAPQTVSGGLFCDLYRDLGPRGLAVTLLGLTSNVGPLVGPVVAGFTSARPPGAWRWQFWRVLLL
LLLLLLPPLGMRVVMMPMAVPVGATARTRRLPPLPSR*
Coding >Hirsu2|4188
ATGGTGGTGGCGAGCCGGATCTGGCCCCGGCCGGAGTACTACGACCACGGCGCCGGCGGCCCCGGCGCCGGGCCC
CACCGGTCCGGCTCCGGCCCCGCCCGGTCCGGCTCCGGCGGGGGCGGCGACGACAGCGGCTGCCGCTGCCCCCGG
GGCGAACATGCCCGCAAGCTCTTCGTCTCGGCCACGGTGATCCTGCTCAACTTCAACGTGACGCTCGCGTCGTCG
CTGCCGAGCGGGGCGGAGCCGGCGCTCAGCGCGCACTTCGGCGTGACGTCGGAGCTGCAGCGGTCGCTGCCCGTC
GCCGTCTTCCTGGCCGGCTACATCGTCGGCCCCGTCGTGGTGGCGCCGCTGTCCGAGTCGCTCGGGCGGCGGCCC
ATCTTCCTGGCCGCCTTCGGGCTGCACACGGCCTTCACGCTCGGCTGCGCGCTGGCGCCCGGCTGGGCCGCCCTC
CGGGCCTTCCGCCTCGTCCTCGGCTGCGCCGCCGCCGCCCCCCAGACCGTGTCCGGCGGCCTGTTCTGCGACCTG
TACCGCGACCTCGGCCCGCGCGGCCTGGCCGTCACCCTGCTCGGCCTCACCAGCAACGTCGGGCCCCTGGTCGGG
CCCGTGGTCGCCGGCTTCACCTCGGCCCGCCCGCCCGGCGCCTGGCGCTGGCAGTTCTGGCGCGTGCTGCTGCTG
CTGCTGCTGCTGCTGCTACCGCCGCTGGGAATGCGGGTCGTGATGATGCCGATGGCAGTGCCGGTGGGCGCGACG
GCGAGGACAAGACGACTGCCGCCCCTGCCGTCACGGTGA
Transcript >Hirsu2|4188
ATGGTGGTGGCGAGCCGGATCTGGCCCCGGCCGGAGTACTACGACCACGGCGCCGGCGGCCCCGGCGCCGGGCCC
CACCGGTCCGGCTCCGGCCCCGCCCGGTCCGGCTCCGGCGGGGGCGGCGACGACAGCGGCTGCCGCTGCCCCCGG
GGCGAACATGCCCGCAAGCTCTTCGTCTCGGCCACGGTGATCCTGCTCAACTTCAACGTGACGCTCGCGTCGTCG
CTGCCGAGCGGGGCGGAGCCGGCGCTCAGCGCGCACTTCGGCGTGACGTCGGAGCTGCAGCGGTCGCTGCCCGTC
GCCGTCTTCCTGGCCGGCTACATCGTCGGCCCCGTCGTGGTGGCGCCGCTGTCCGAGTCGCTCGGGCGGCGGCCC
ATCTTCCTGGCCGCCTTCGGGCTGCACACGGCCTTCACGCTCGGCTGCGCGCTGGCGCCCGGCTGGGCCGCCCTC
CGGGCCTTCCGCCTCGTCCTCGGCTGCGCCGCCGCCGCCCCCCAGACCGTGTCCGGCGGCCTGTTCTGCGACCTG
TACCGCGACCTCGGCCCGCGCGGCCTGGCCGTCACCCTGCTCGGCCTCACCAGCAACGTCGGGCCCCTGGTCGGG
CCCGTGGTCGCCGGCTTCACCTCGGCCCGCCCGCCCGGCGCCTGGCGCTGGCAGTTCTGGCGCGTGCTGCTGCTG
CTGCTGCTGCTGCTGCTACCGCCGCTGGGAATGCGGGTCGTGATGATGCCGATGGCAGTGCCGGTGGGCGCGACG
GCGAGGACAAGACGACTGCCGCCCCTGCCGTCACGGTGA
Gene >Hirsu2|4188
ATGGTGGTGGTGCGTTGTCGAATCTGGAATGCTGCCCGGCCGACAGACGACGTTCTAGCCCCCTTTCTCAGCCGC
CCGAAATAAGCAACGCGCCGATGCCAATGGCCGCCATTTTCAGGCGAGCCGGATCTGGCCCCGGCCGGAGTACTA
CGACCACGGCGCCGGCGGCCCCGGCGCCGGGCCCCACCGGTCCGGCTCCGGCCCCGCCCGGTCCGGCTCCGGCGG
GGGCGGCGACGACAGCGGCTGCCGCTGCCCCCGGGGCGAACATGTCGAGTGCAAGTCTCTCCTTGTCTCTTTCTC
ATATCCTGATGCATGTGGATTGCTCATCCTGACGCGGAAAAAAAAAGGCCCGCAAGCTCTTCGTCTCGGCCACGG
TGATCCTGCTCAACTTCAACGTGACGCTCGCGTCGTCGCTGCCGAGCGGGGCGGAGCCGGCGCTCAGCGCGCACT
TCGGCGTGACGTCGGAGCTGCAGCGGTCGCTGCCCGTCGCCGTCTTCCTGGCCGGCTACATCGTCGGCCCCGTCG
TGGTGGCGCCGCTGTCCGAGTCGCTCGGGCGGCGGCCCATCTTCCTGGCCGCCTTCGGGCTGCACACGGCCTTCA
CGCTCGGCTGCGCGCTGGCGCCCGGCTGGGCCGCCCTCCGGGCCTTCCGCCTCGTCCTCGGCTGCGCCGCCGCCG
CCCCCCAGACCGTGTCCGGCGGCCTGTTCTGCGACCTGTACCGCGACCTCGGCCCGCGCGGCCTGGCCGTCACCC
TGCTCGGCCTCACCAGCAACGTCGGGCCCCTGGTCGGGCCCGTGGTCGCCGGCTTCACCTCGGCCCGCCCGCCCG
GCGCCTGGCGCTGGCAGTTCTGGTGCTCGCTCGGCCTGGCCGGCCTTAACTGGCCCTTGCTGCTGCTCATGCCCG
AGACCTTTGCCCCCGTCCTCCAGGCGCGTGCTGCTGCTGCTGCTGCTGCTGCTGCTACCGCCGCTGGGAATGCGG
GTCGTGATGATGCCGATGGCAGTGCCGGTGGGCGCGACGGCGAGGACAAGACGACTGCCGCCCCTGCCGTCACGG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail