Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4188
Gene name
LocationContig_2157:2453..3506
Strand+
Gene length (bp)1053
Transcript length (bp)789
Coding sequence length (bp)789
Protein length (aa) 263

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.2E-16 64 234
PF00083 Sugar_tr Sugar (and other) transporter 3.5E-08 60 230

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 56 231 1.0E-17
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 55 217 1.0E-15
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 72 225 1.0E-15
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 55 217 3.0E-14
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 55 220 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 56 231 1.0E-17
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 55 217 1.0E-15
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 72 225 1.0E-15
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 55 217 3.0E-14
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 55 220 2.0E-13
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 55 217 2.0E-12
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 53 225 2.0E-12
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 53 225 3.0E-12
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 98 230 3.0E-12
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 15 224 3.0E-12
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 87 208 4.0E-12
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 49 220 6.0E-12
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 20 217 3.0E-11
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 87 208 3.0E-11
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 77 237 4.0E-11
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 48 227 4.0E-11
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 55 262 4.0E-10
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 72 217 5.0E-10
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 40 225 2.0E-09
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 70 217 5.0E-09
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 54 246 5.0E-09
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 56 231 5.0E-08
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 40 255 7.0E-08
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 40 255 7.0E-08
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 82 225 2.0E-07
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 56 225 5.0E-07
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 80 220 5.0E-06
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 49 233 5.0E-06
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 2 220 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 99 121 22
3 126 148 22
4 184 206 22
5 219 241 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4188
MVVASRIWPRPEYYDHGAGGPGAGPHRSGSGPARSGSGGGGDDSGCRCPRGEHARKLFVSATVILLNFNVTLASS
LPSGAEPALSAHFGVTSELQRSLPVAVFLAGYIVGPVVVAPLSESLGRRPIFLAAFGLHTAFTLGCALAPGWAAL
RAFRLVLGCAAAAPQTVSGGLFCDLYRDLGPRGLAVTLLGLTSNVGPLVGPVVAGFTSARPPGAWRWQFWRVLLL
LLLLLLPPLGMRVVMMPMAVPVGATARTRRLPPLPSR*
Coding >Hirsu2|4188
ATGGTGGTGGCGAGCCGGATCTGGCCCCGGCCGGAGTACTACGACCACGGCGCCGGCGGCCCCGGCGCCGGGCCC
CACCGGTCCGGCTCCGGCCCCGCCCGGTCCGGCTCCGGCGGGGGCGGCGACGACAGCGGCTGCCGCTGCCCCCGG
GGCGAACATGCCCGCAAGCTCTTCGTCTCGGCCACGGTGATCCTGCTCAACTTCAACGTGACGCTCGCGTCGTCG
CTGCCGAGCGGGGCGGAGCCGGCGCTCAGCGCGCACTTCGGCGTGACGTCGGAGCTGCAGCGGTCGCTGCCCGTC
GCCGTCTTCCTGGCCGGCTACATCGTCGGCCCCGTCGTGGTGGCGCCGCTGTCCGAGTCGCTCGGGCGGCGGCCC
ATCTTCCTGGCCGCCTTCGGGCTGCACACGGCCTTCACGCTCGGCTGCGCGCTGGCGCCCGGCTGGGCCGCCCTC
CGGGCCTTCCGCCTCGTCCTCGGCTGCGCCGCCGCCGCCCCCCAGACCGTGTCCGGCGGCCTGTTCTGCGACCTG
TACCGCGACCTCGGCCCGCGCGGCCTGGCCGTCACCCTGCTCGGCCTCACCAGCAACGTCGGGCCCCTGGTCGGG
CCCGTGGTCGCCGGCTTCACCTCGGCCCGCCCGCCCGGCGCCTGGCGCTGGCAGTTCTGGCGCGTGCTGCTGCTG
CTGCTGCTGCTGCTGCTACCGCCGCTGGGAATGCGGGTCGTGATGATGCCGATGGCAGTGCCGGTGGGCGCGACG
GCGAGGACAAGACGACTGCCGCCCCTGCCGTCACGGTGA
Transcript >Hirsu2|4188
ATGGTGGTGGCGAGCCGGATCTGGCCCCGGCCGGAGTACTACGACCACGGCGCCGGCGGCCCCGGCGCCGGGCCC
CACCGGTCCGGCTCCGGCCCCGCCCGGTCCGGCTCCGGCGGGGGCGGCGACGACAGCGGCTGCCGCTGCCCCCGG
GGCGAACATGCCCGCAAGCTCTTCGTCTCGGCCACGGTGATCCTGCTCAACTTCAACGTGACGCTCGCGTCGTCG
CTGCCGAGCGGGGCGGAGCCGGCGCTCAGCGCGCACTTCGGCGTGACGTCGGAGCTGCAGCGGTCGCTGCCCGTC
GCCGTCTTCCTGGCCGGCTACATCGTCGGCCCCGTCGTGGTGGCGCCGCTGTCCGAGTCGCTCGGGCGGCGGCCC
ATCTTCCTGGCCGCCTTCGGGCTGCACACGGCCTTCACGCTCGGCTGCGCGCTGGCGCCCGGCTGGGCCGCCCTC
CGGGCCTTCCGCCTCGTCCTCGGCTGCGCCGCCGCCGCCCCCCAGACCGTGTCCGGCGGCCTGTTCTGCGACCTG
TACCGCGACCTCGGCCCGCGCGGCCTGGCCGTCACCCTGCTCGGCCTCACCAGCAACGTCGGGCCCCTGGTCGGG
CCCGTGGTCGCCGGCTTCACCTCGGCCCGCCCGCCCGGCGCCTGGCGCTGGCAGTTCTGGCGCGTGCTGCTGCTG
CTGCTGCTGCTGCTGCTACCGCCGCTGGGAATGCGGGTCGTGATGATGCCGATGGCAGTGCCGGTGGGCGCGACG
GCGAGGACAAGACGACTGCCGCCCCTGCCGTCACGGTGA
Gene >Hirsu2|4188
ATGGTGGTGGTGCGTTGTCGAATCTGGAATGCTGCCCGGCCGACAGACGACGTTCTAGCCCCCTTTCTCAGCCGC
CCGAAATAAGCAACGCGCCGATGCCAATGGCCGCCATTTTCAGGCGAGCCGGATCTGGCCCCGGCCGGAGTACTA
CGACCACGGCGCCGGCGGCCCCGGCGCCGGGCCCCACCGGTCCGGCTCCGGCCCCGCCCGGTCCGGCTCCGGCGG
GGGCGGCGACGACAGCGGCTGCCGCTGCCCCCGGGGCGAACATGTCGAGTGCAAGTCTCTCCTTGTCTCTTTCTC
ATATCCTGATGCATGTGGATTGCTCATCCTGACGCGGAAAAAAAAAGGCCCGCAAGCTCTTCGTCTCGGCCACGG
TGATCCTGCTCAACTTCAACGTGACGCTCGCGTCGTCGCTGCCGAGCGGGGCGGAGCCGGCGCTCAGCGCGCACT
TCGGCGTGACGTCGGAGCTGCAGCGGTCGCTGCCCGTCGCCGTCTTCCTGGCCGGCTACATCGTCGGCCCCGTCG
TGGTGGCGCCGCTGTCCGAGTCGCTCGGGCGGCGGCCCATCTTCCTGGCCGCCTTCGGGCTGCACACGGCCTTCA
CGCTCGGCTGCGCGCTGGCGCCCGGCTGGGCCGCCCTCCGGGCCTTCCGCCTCGTCCTCGGCTGCGCCGCCGCCG
CCCCCCAGACCGTGTCCGGCGGCCTGTTCTGCGACCTGTACCGCGACCTCGGCCCGCGCGGCCTGGCCGTCACCC
TGCTCGGCCTCACCAGCAACGTCGGGCCCCTGGTCGGGCCCGTGGTCGCCGGCTTCACCTCGGCCCGCCCGCCCG
GCGCCTGGCGCTGGCAGTTCTGGTGCTCGCTCGGCCTGGCCGGCCTTAACTGGCCCTTGCTGCTGCTCATGCCCG
AGACCTTTGCCCCCGTCCTCCAGGCGCGTGCTGCTGCTGCTGCTGCTGCTGCTGCTACCGCCGCTGGGAATGCGG
GTCGTGATGATGCCGATGGCAGTGCCGGTGGGCGCGACGGCGAGGACAAGACGACTGCCGCCCCTGCCGTCACGG
TGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail