Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4185
Gene name
LocationContig_2155:913..3372
Strand-
Gene length (bp)2459
Transcript length (bp)2313
Coding sequence length (bp)2313
Protein length (aa) 771

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10291 muHD Muniscin C-terminal mu homology domain 6.8E-66 497 769

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25623|SYP1_YEAST Suppressor of yeast profilin deletion OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYP1 PE=1 SV=3 17 116 2.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7015 0.2775 0.1152 0.3067 0.0703 0.0013 0.1308 0.2626 0.3645 0.0038

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup538
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6603
Ophiocordyceps australis map64 (Brazil) OphauB2|8106
Ophiocordyceps camponoti-floridani Ophcf2|06279
Ophiocordyceps camponoti-rufipedis Ophun1|3074
Ophiocordyceps camponoti-rufipedis Ophun1|4973
Ophiocordyceps kimflemingae Ophio5|1721
Ophiocordyceps subramaniannii Hirsu2|3612
Ophiocordyceps subramaniannii Hirsu2|4185 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4185
MHNIASNLGAMAKDLEDAQDKSEKLSRKGAKASAQKVDAASSRLESSTQQWESQAPFVFETLQALDESRVNQLRD
LLTQYQTHEADQAQRAQNNAVEALAAMLEISTEKEVRDFAQRTTGAKPPASTRPSVRRMSFVTGGGAHPRQPTAP
DAPSSLPGGPTDSAASPGPPAPTNPPTPGDDDASDQNSFPADAKPGSKLRRLGTMLGGRRRQSVHGGFGGLTPQR
TGPANFGRLGSSHGRVSPRPSTSNLNQDSGRLSALAETPDRASQDETAADQSKPAHEGTNGVTAGSDSLLDAPSP
AAAAAPGMNGTHAADVIDDVPPPPGPPPGQLAEAPPALAKDSEGFTVRAPMNDPISEAQRDAAADEADQPFKLNI
QNQPVEEEDPEAKMAALSSVANSLKVGPATRRSSTIRGRRDVRNTIYVHTPTSSVRESQSDSAMPSIAGSPPATS
SSFSRPPALAALASEASIAGTSDTQSVRSGNSLGSLPHAKHPDMTGPGLNSSIIETVSAVFEGGVVKSASIAGEI
ALQHNAPDPSGKMQSVIRINNFASLERIGPNRIFVQNSSSDQPDQFTVDVSHLARTSIAFSYRVFAEEAETPALG
RHAPLLLKPAWKPQGDKLGLLLQYQLNPSAQFASPTTLHNVVFVARYEGKATSAQTKPSGTHLKDKHLVYWRLGD
VTLTGDVQKIVCRIAGADGAAPVPGHVEARWEYAAAGGEARGSGISLSRLDDDGDKGAEDDPFADQSQAIAAAAG
QTWVDVPAQRRLVSGKYEGR*
Coding >Hirsu2|4185
ATGCACAACATCGCCAGCAACCTCGGCGCCATGGCCAAGGACCTGGAGGACGCGCAGGACAAGTCGGAAAAGCTC
AGCCGCAAGGGCGCAAAGGCCAGCGCCCAAAAGGTCGACGCCGCCTCCTCGAGGCTCGAGTCGTCCACGCAGCAG
TGGGAGTCGCAGGCCCCCTTCGTCTTCGAGACGCTGCAGGCCCTGGACGAGTCGCGCGTCAACCAGCTGCGCGAC
CTCCTGACTCAGTACCAGACACACGAGGCCGACCAGGCCCAGCGGGCCCAGAACAACGCCGTCGAGGCCCTGGCC
GCCATGCTCGAGATCAGCACCGAAAAGGAGGTTCGAGACTTCGCCCAGCGCACCACCGGCGCCAAGCCCCCTGCC
AGCACCCGGCCGTCCGTCCGCCGCATGTCGTTCGTGACCGGCGGCGGCGCGCATCCCAGGCAGCCCACCGCGCCC
GACGCCCCATCCTCGCTCCCCGGAGGCCCGACGGACAGCGCAGCCTCCCCGGGCCCTCCCGCCCCGACAAACCCC
CCGACGCCGGGCGACGATGACGCCAGCGACCAGAATTCGTTCCCCGCCGACGCGAAGCCAGGCTCCAAGTTGCGG
CGGCTCGGAACCATGCTGGGTGGCCGCCGCCGGCAGAGCGTCCATGGCGGTTTCGGGGGGCTGACGCCCCAAAGG
ACTGGCCCGGCCAATTTTGGGCGCCTGGGCAGCAGCCACGGCCGCGTCTCTCCACGGCCGTCGACCAGCAACCTC
AACCAAGACTCGGGCCGACTGTCCGCCCTCGCCGAGACCCCTGACCGGGCCAGCCAAGACGAGACGGCCGCGGAT
CAGAGCAAGCCCGCCCACGAGGGCACCAACGGTGTGACTGCCGGTAGCGACTCGTTACTGGATGCTCCCTCCCCC
GCGGCGGCGGCCGCCCCGGGGATGAACGGGACTCACGCGGCCGACGTCATCGACGATGTTCCTCCCCCGCCGGGG
CCGCCACCGGGCCAGCTGGCCGAAGCACCACCGGCGTTGGCCAAGGACTCGGAGGGCTTCACCGTCCGCGCGCCA
ATGAACGACCCCATCTCCGAGGCCCAGCGCGACGCCGCCGCCGACGAGGCGGACCAGCCCTTCAAGCTCAACATC
CAGAACCAGCCGGTCGAGGAGGAAGACCCCGAGGCCAAGATGGCCGCGCTGTCGAGCGTCGCCAACTCGCTCAAG
GTCGGGCCGGCGACCCGCCGCTCCAGCACCATCAGAGGGCGCCGCGACGTGCGCAACACCATCTACGTGCACACG
CCCACCTCGAGCGTGCGCGAGAGCCAGTCCGACAGCGCGATGCCATCCATTGCCGGCTCCCCGCCCGCCACCTCG
TCGTCTTTCTCCCGCCCGCCCGCCCTCGCCGCGTTGGCGTCCGAGGCCAGCATCGCCGGCACGTCGGACACGCAG
TCGGTGCGGTCCGGCAACTCGCTGGGCAGCCTGCCCCACGCCAAGCATCCCGACATGACGGGCCCGGGCCTGAAC
AGCTCCATCATCGAGACGGTCTCGGCCGTCTTCGAGGGCGGGGTGGTCAAGAGCGCGTCGATTGCGGGCGAGATT
GCCCTGCAGCACAACGCGCCGGATCCGAGTGGTAAGATGCAATCGGTCATCCGGATCAACAACTTTGCGAGCCTC
GAACGCATCGGCCCGAACCGCATCTTCGTCCAAAACTCGTCGTCCGACCAGCCCGACCAGTTCACCGTCGACGTC
TCGCACCTAGCCAGGACCTCCATCGCCTTCTCCTACCGCGTGTTTGCCGAGGAGGCCGAGACGCCCGCCCTCGGC
CGGCACGCGCCGTTGCTGCTGAAGCCGGCCTGGAAGCCGCAGGGCGACAAGCTGGGCCTCCTGCTGCAGTACCAG
CTCAACCCGTCGGCGCAGTTCGCGTCGCCGACGACGCTGCACAACGTCGTCTTCGTTGCCCGGTACGAGGGCAAG
GCCACGAGCGCGCAGACCAAGCCCAGCGGGACGCACCTCAAGGACAAGCACCTGGTCTACTGGCGGCTGGGCGAC
GTGACGCTCACGGGCGACGTGCAGAAGATCGTCTGCCGCATCGCCGGGGCCGACGGCGCGGCGCCGGTCCCCGGG
CACGTCGAGGCTCGATGGGAGTACGCGGCGGCGGGCGGCGAGGCCCGAGGCAGCGGCATCTCCCTCTCGCGGCTG
GACGACGATGGCGACAAGGGCGCCGAGGACGATCCGTTCGCCGACCAGAGCCAGGCGATTGCGGCGGCAGCAGGA
CAGACGTGGGTCGACGTGCCGGCGCAGAGGAGGCTGGTGAGCGGCAAGTACGAGGGCAGGTGA
Transcript >Hirsu2|4185
ATGCACAACATCGCCAGCAACCTCGGCGCCATGGCCAAGGACCTGGAGGACGCGCAGGACAAGTCGGAAAAGCTC
AGCCGCAAGGGCGCAAAGGCCAGCGCCCAAAAGGTCGACGCCGCCTCCTCGAGGCTCGAGTCGTCCACGCAGCAG
TGGGAGTCGCAGGCCCCCTTCGTCTTCGAGACGCTGCAGGCCCTGGACGAGTCGCGCGTCAACCAGCTGCGCGAC
CTCCTGACTCAGTACCAGACACACGAGGCCGACCAGGCCCAGCGGGCCCAGAACAACGCCGTCGAGGCCCTGGCC
GCCATGCTCGAGATCAGCACCGAAAAGGAGGTTCGAGACTTCGCCCAGCGCACCACCGGCGCCAAGCCCCCTGCC
AGCACCCGGCCGTCCGTCCGCCGCATGTCGTTCGTGACCGGCGGCGGCGCGCATCCCAGGCAGCCCACCGCGCCC
GACGCCCCATCCTCGCTCCCCGGAGGCCCGACGGACAGCGCAGCCTCCCCGGGCCCTCCCGCCCCGACAAACCCC
CCGACGCCGGGCGACGATGACGCCAGCGACCAGAATTCGTTCCCCGCCGACGCGAAGCCAGGCTCCAAGTTGCGG
CGGCTCGGAACCATGCTGGGTGGCCGCCGCCGGCAGAGCGTCCATGGCGGTTTCGGGGGGCTGACGCCCCAAAGG
ACTGGCCCGGCCAATTTTGGGCGCCTGGGCAGCAGCCACGGCCGCGTCTCTCCACGGCCGTCGACCAGCAACCTC
AACCAAGACTCGGGCCGACTGTCCGCCCTCGCCGAGACCCCTGACCGGGCCAGCCAAGACGAGACGGCCGCGGAT
CAGAGCAAGCCCGCCCACGAGGGCACCAACGGTGTGACTGCCGGTAGCGACTCGTTACTGGATGCTCCCTCCCCC
GCGGCGGCGGCCGCCCCGGGGATGAACGGGACTCACGCGGCCGACGTCATCGACGATGTTCCTCCCCCGCCGGGG
CCGCCACCGGGCCAGCTGGCCGAAGCACCACCGGCGTTGGCCAAGGACTCGGAGGGCTTCACCGTCCGCGCGCCA
ATGAACGACCCCATCTCCGAGGCCCAGCGCGACGCCGCCGCCGACGAGGCGGACCAGCCCTTCAAGCTCAACATC
CAGAACCAGCCGGTCGAGGAGGAAGACCCCGAGGCCAAGATGGCCGCGCTGTCGAGCGTCGCCAACTCGCTCAAG
GTCGGGCCGGCGACCCGCCGCTCCAGCACCATCAGAGGGCGCCGCGACGTGCGCAACACCATCTACGTGCACACG
CCCACCTCGAGCGTGCGCGAGAGCCAGTCCGACAGCGCGATGCCATCCATTGCCGGCTCCCCGCCCGCCACCTCG
TCGTCTTTCTCCCGCCCGCCCGCCCTCGCCGCGTTGGCGTCCGAGGCCAGCATCGCCGGCACGTCGGACACGCAG
TCGGTGCGGTCCGGCAACTCGCTGGGCAGCCTGCCCCACGCCAAGCATCCCGACATGACGGGCCCGGGCCTGAAC
AGCTCCATCATCGAGACGGTCTCGGCCGTCTTCGAGGGCGGGGTGGTCAAGAGCGCGTCGATTGCGGGCGAGATT
GCCCTGCAGCACAACGCGCCGGATCCGAGTGGTAAGATGCAATCGGTCATCCGGATCAACAACTTTGCGAGCCTC
GAACGCATCGGCCCGAACCGCATCTTCGTCCAAAACTCGTCGTCCGACCAGCCCGACCAGTTCACCGTCGACGTC
TCGCACCTAGCCAGGACCTCCATCGCCTTCTCCTACCGCGTGTTTGCCGAGGAGGCCGAGACGCCCGCCCTCGGC
CGGCACGCGCCGTTGCTGCTGAAGCCGGCCTGGAAGCCGCAGGGCGACAAGCTGGGCCTCCTGCTGCAGTACCAG
CTCAACCCGTCGGCGCAGTTCGCGTCGCCGACGACGCTGCACAACGTCGTCTTCGTTGCCCGGTACGAGGGCAAG
GCCACGAGCGCGCAGACCAAGCCCAGCGGGACGCACCTCAAGGACAAGCACCTGGTCTACTGGCGGCTGGGCGAC
GTGACGCTCACGGGCGACGTGCAGAAGATCGTCTGCCGCATCGCCGGGGCCGACGGCGCGGCGCCGGTCCCCGGG
CACGTCGAGGCTCGATGGGAGTACGCGGCGGCGGGCGGCGAGGCCCGAGGCAGCGGCATCTCCCTCTCGCGGCTG
GACGACGATGGCGACAAGGGCGCCGAGGACGATCCGTTCGCCGACCAGAGCCAGGCGATTGCGGCGGCAGCAGGA
CAGACGTGGGTCGACGTGCCGGCGCAGAGGAGGCTGGTGAGCGGCAAGTACGAGGGCAGGTGA
Gene >Hirsu2|4185
ATGCACAACATCGCCAGCAACCTCGGCGCCATGGCCAAGGACCTGGAGGACGCGCAGGACAAGTCGGAAAAGCTC
AGCCGCAAGGGCGCAAAGGCCAGCGCCCAAAAGGTCGACGCCGCCTCCTCGAGGCTCGAGTCGTCCACGCAGCAG
TGGGAGTCGCAGGCCCCCTTCGTCTTCGAGACGCTGCAGGCCCTGGACGAGTCGCGCGTCAACCAGCTGCGCGAC
CTCCTGACTCAGTACCAGACACACGAGGCCGACCAGGCCCAGCGGGCCCAGAACAACGCCGTCGAGGCCCTGGCC
GCCATGCTCGAGATCAGCACCGAAAAGGAGGTTCGAGACTTCGCCCAGCGCACCACCGGCGCCAAGCCCCCTGCC
AGCACCCGGCCGTCCGTCCGCCGCATGTCGTTCGTGACCGGCGGCGGCGCGCATCCCAGGCAGCCCACCGCGCCC
GACGCCCCATCCTCGCTCCCCGGAGGCCCGACGGACAGCGCAGCCTCCCCGGGCCCTCCCGCCCCGACAAACCCC
CCGACGCCGGGCGACGATGACGCCAGCGACCAGAATTCGTTCCCCGCCGACGCGAAGCCAGGTACACCGACCCCC
GCCGCCCCCCAGAAGGACTCGTGGCCGGACCTAACCGTCTTGCAGGCTCCAAGTTGCGGCGGCTCGGAACCATGC
TGGGTGGCCGCCGCCGGCAGAGCGTCCATGGCGGTTTCGGGGGGCTGACGCCCCAAAGGACTGGCCCGGCCAATT
TTGGGCGCCTGGGCAGCAGCCACGGCCGCGTCTCTCCACGGCCGTCGACCAGCAACCTCAACCAAGACTCGGGCC
GACTGTCCGCCCTCGCCGAGACCCCTGACCGGGCCAGCCAAGACGAGACGGCCGCGGATCAGAGCAAGCCCGCCC
ACGAGGGCACCAACGGTGTGACTGCCGGTAGCGACTCGTTACTGGATGCTCCCTCCCCCGCGGCGGCGGCCGCCC
CGGGGATGAACGGGACTCACGCGGCCGACGTCATCGACGATGTTCCTCCCCCGCCGGGGCCGCCACCGGGCCAGC
TGGCCGAAGCACCACCGGCGTTGGCCAAGGACTCGGAGGGCTTCACCGTCCGCGCGCCAATGAACGACCCCATCT
CCGAGGCCCAGCGCGACGCCGCCGCCGACGAGGCGGACCAGCCCTTCAAGCTCAACATCCAGAACCAGCCGGTCG
AGGAGGAAGACCCCGAGGCCAAGATGGCCGCGCTGTCGAGCGTCGCCAACTCGCTCAAGGTCGGGCCGGCGACCC
GCCGCTCCAGCACCATCAGAGGGCGCCGCGACGTGCGCAACACCATCTACGTGCACACGCCCACCTCGAGCGTGC
GCGAGAGCCAGTCCGACAGCGCGATGCCATCCATTGCCGGCTCCCCGCCCGCCACCTCGTCGTCTTTCTCCCGCC
CGCCCGCCCTCGCCGCGTTGGCGTCCGAGGCCAGCATCGCCGGCACGTCGGACACGCAGTCGGTGCGGTCCGGCA
ACTCGCTGGGCAGCCTGCCCCACGCCAAGCATCCCGACATGACGGGCCCGGGCCTGAACAGCTCCATCATCGAGA
CGGTCTCGGCCGTCTTCGAGGGCGGGGTGGTCAAGAGCGCGTCGATTGCGGGCGAGATTGCCCTGCAGCACAACG
CGCCGGATCCGAGTGGTAAGAGTAGGGACCCCCCCCCCCCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCCA
GGCCCCCTTCCATCTGACGAACCATGTGCGCAGTGCAATCGGTCATCCGGATCAACAACTTTGCGAGCCTCGAAC
GCATCGGCCCGAACCGCATCTTCGTCCAAAACTCGTCGTCCGACCAGCCCGACCAGTTCACCGTCGACGTCTCGC
ACCTAGCCAGGACCTCCATCGCCTTCTCCTACCGCGTGTTTGCCGAGGAGGCCGAGACGCCCGCCCTCGGCCGGC
ACGCGCCGTTGCTGCTGAAGCCGGCCTGGAAGCCGCAGGGCGACAAGCTGGGCCTCCTGCTGCAGTACCAGCTCA
ACCCGTCGGCGCAGTTCGCGTCGCCGACGACGCTGCACAACGTCGTCTTCGTTGCCCGGTACGAGGGCAAGGCCA
CGAGCGCGCAGACCAAGCCCAGCGGGACGCACCTCAAGGACAAGCACCTGGTCTACTGGCGGCTGGGCGACGTGA
CGCTCACGGGCGACGTGCAGAAGATCGTCTGCCGCATCGCCGGGGCCGACGGCGCGGCGCCGGTCCCCGGGCACG
TCGAGGCTCGATGGGAGTACGCGGCGGCGGGCGGCGAGGCCCGAGGCAGCGGCATCTCCCTCTCGCGGCTGGACG
ACGATGGCGACAAGGGCGCCGAGGACGATCCGTTCGCCGACCAGAGCCAGGCGATTGCGGCGGCAGCAGGACAGA
CGTGGGTCGACGTGCCGGCGCAGAGGAGGCTGGTGAGCGGCAAGTACGAGGGCAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail