Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4185
Gene name
LocationContig_2155:913..3372
Strand-
Gene length (bp)2459
Transcript length (bp)2313
Coding sequence length (bp)2313
Protein length (aa) 771

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10291 muHD Muniscin C-terminal mu homology domain 1.2E-65 497 769

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25623|SYP1_YEAST Suppressor of yeast profilin deletion OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYP1 PE=1 SV=3 17 116 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4185
MHNIASNLGAMAKDLEDAQDKSEKLSRKGAKASAQKVDAASSRLESSTQQWESQAPFVFETLQALDESRVNQLRD
LLTQYQTHEADQAQRAQNNAVEALAAMLEISTEKEVRDFAQRTTGAKPPASTRPSVRRMSFVTGGGAHPRQPTAP
DAPSSLPGGPTDSAASPGPPAPTNPPTPGDDDASDQNSFPADAKPGSKLRRLGTMLGGRRRQSVHGGFGGLTPQR
TGPANFGRLGSSHGRVSPRPSTSNLNQDSGRLSALAETPDRASQDETAADQSKPAHEGTNGVTAGSDSLLDAPSP
AAAAAPGMNGTHAADVIDDVPPPPGPPPGQLAEAPPALAKDSEGFTVRAPMNDPISEAQRDAAADEADQPFKLNI
QNQPVEEEDPEAKMAALSSVANSLKVGPATRRSSTIRGRRDVRNTIYVHTPTSSVRESQSDSAMPSIAGSPPATS
SSFSRPPALAALASEASIAGTSDTQSVRSGNSLGSLPHAKHPDMTGPGLNSSIIETVSAVFEGGVVKSASIAGEI
ALQHNAPDPSGKMQSVIRINNFASLERIGPNRIFVQNSSSDQPDQFTVDVSHLARTSIAFSYRVFAEEAETPALG
RHAPLLLKPAWKPQGDKLGLLLQYQLNPSAQFASPTTLHNVVFVARYEGKATSAQTKPSGTHLKDKHLVYWRLGD
VTLTGDVQKIVCRIAGADGAAPVPGHVEARWEYAAAGGEARGSGISLSRLDDDGDKGAEDDPFADQSQAIAAAAG
QTWVDVPAQRRLVSGKYEGR*
Coding >Hirsu2|4185
ATGCACAACATCGCCAGCAACCTCGGCGCCATGGCCAAGGACCTGGAGGACGCGCAGGACAAGTCGGAAAAGCTC
AGCCGCAAGGGCGCAAAGGCCAGCGCCCAAAAGGTCGACGCCGCCTCCTCGAGGCTCGAGTCGTCCACGCAGCAG
TGGGAGTCGCAGGCCCCCTTCGTCTTCGAGACGCTGCAGGCCCTGGACGAGTCGCGCGTCAACCAGCTGCGCGAC
CTCCTGACTCAGTACCAGACACACGAGGCCGACCAGGCCCAGCGGGCCCAGAACAACGCCGTCGAGGCCCTGGCC
GCCATGCTCGAGATCAGCACCGAAAAGGAGGTTCGAGACTTCGCCCAGCGCACCACCGGCGCCAAGCCCCCTGCC
AGCACCCGGCCGTCCGTCCGCCGCATGTCGTTCGTGACCGGCGGCGGCGCGCATCCCAGGCAGCCCACCGCGCCC
GACGCCCCATCCTCGCTCCCCGGAGGCCCGACGGACAGCGCAGCCTCCCCGGGCCCTCCCGCCCCGACAAACCCC
CCGACGCCGGGCGACGATGACGCCAGCGACCAGAATTCGTTCCCCGCCGACGCGAAGCCAGGCTCCAAGTTGCGG
CGGCTCGGAACCATGCTGGGTGGCCGCCGCCGGCAGAGCGTCCATGGCGGTTTCGGGGGGCTGACGCCCCAAAGG
ACTGGCCCGGCCAATTTTGGGCGCCTGGGCAGCAGCCACGGCCGCGTCTCTCCACGGCCGTCGACCAGCAACCTC
AACCAAGACTCGGGCCGACTGTCCGCCCTCGCCGAGACCCCTGACCGGGCCAGCCAAGACGAGACGGCCGCGGAT
CAGAGCAAGCCCGCCCACGAGGGCACCAACGGTGTGACTGCCGGTAGCGACTCGTTACTGGATGCTCCCTCCCCC
GCGGCGGCGGCCGCCCCGGGGATGAACGGGACTCACGCGGCCGACGTCATCGACGATGTTCCTCCCCCGCCGGGG
CCGCCACCGGGCCAGCTGGCCGAAGCACCACCGGCGTTGGCCAAGGACTCGGAGGGCTTCACCGTCCGCGCGCCA
ATGAACGACCCCATCTCCGAGGCCCAGCGCGACGCCGCCGCCGACGAGGCGGACCAGCCCTTCAAGCTCAACATC
CAGAACCAGCCGGTCGAGGAGGAAGACCCCGAGGCCAAGATGGCCGCGCTGTCGAGCGTCGCCAACTCGCTCAAG
GTCGGGCCGGCGACCCGCCGCTCCAGCACCATCAGAGGGCGCCGCGACGTGCGCAACACCATCTACGTGCACACG
CCCACCTCGAGCGTGCGCGAGAGCCAGTCCGACAGCGCGATGCCATCCATTGCCGGCTCCCCGCCCGCCACCTCG
TCGTCTTTCTCCCGCCCGCCCGCCCTCGCCGCGTTGGCGTCCGAGGCCAGCATCGCCGGCACGTCGGACACGCAG
TCGGTGCGGTCCGGCAACTCGCTGGGCAGCCTGCCCCACGCCAAGCATCCCGACATGACGGGCCCGGGCCTGAAC
AGCTCCATCATCGAGACGGTCTCGGCCGTCTTCGAGGGCGGGGTGGTCAAGAGCGCGTCGATTGCGGGCGAGATT
GCCCTGCAGCACAACGCGCCGGATCCGAGTGGTAAGATGCAATCGGTCATCCGGATCAACAACTTTGCGAGCCTC
GAACGCATCGGCCCGAACCGCATCTTCGTCCAAAACTCGTCGTCCGACCAGCCCGACCAGTTCACCGTCGACGTC
TCGCACCTAGCCAGGACCTCCATCGCCTTCTCCTACCGCGTGTTTGCCGAGGAGGCCGAGACGCCCGCCCTCGGC
CGGCACGCGCCGTTGCTGCTGAAGCCGGCCTGGAAGCCGCAGGGCGACAAGCTGGGCCTCCTGCTGCAGTACCAG
CTCAACCCGTCGGCGCAGTTCGCGTCGCCGACGACGCTGCACAACGTCGTCTTCGTTGCCCGGTACGAGGGCAAG
GCCACGAGCGCGCAGACCAAGCCCAGCGGGACGCACCTCAAGGACAAGCACCTGGTCTACTGGCGGCTGGGCGAC
GTGACGCTCACGGGCGACGTGCAGAAGATCGTCTGCCGCATCGCCGGGGCCGACGGCGCGGCGCCGGTCCCCGGG
CACGTCGAGGCTCGATGGGAGTACGCGGCGGCGGGCGGCGAGGCCCGAGGCAGCGGCATCTCCCTCTCGCGGCTG
GACGACGATGGCGACAAGGGCGCCGAGGACGATCCGTTCGCCGACCAGAGCCAGGCGATTGCGGCGGCAGCAGGA
CAGACGTGGGTCGACGTGCCGGCGCAGAGGAGGCTGGTGAGCGGCAAGTACGAGGGCAGGTGA
Transcript >Hirsu2|4185
ATGCACAACATCGCCAGCAACCTCGGCGCCATGGCCAAGGACCTGGAGGACGCGCAGGACAAGTCGGAAAAGCTC
AGCCGCAAGGGCGCAAAGGCCAGCGCCCAAAAGGTCGACGCCGCCTCCTCGAGGCTCGAGTCGTCCACGCAGCAG
TGGGAGTCGCAGGCCCCCTTCGTCTTCGAGACGCTGCAGGCCCTGGACGAGTCGCGCGTCAACCAGCTGCGCGAC
CTCCTGACTCAGTACCAGACACACGAGGCCGACCAGGCCCAGCGGGCCCAGAACAACGCCGTCGAGGCCCTGGCC
GCCATGCTCGAGATCAGCACCGAAAAGGAGGTTCGAGACTTCGCCCAGCGCACCACCGGCGCCAAGCCCCCTGCC
AGCACCCGGCCGTCCGTCCGCCGCATGTCGTTCGTGACCGGCGGCGGCGCGCATCCCAGGCAGCCCACCGCGCCC
GACGCCCCATCCTCGCTCCCCGGAGGCCCGACGGACAGCGCAGCCTCCCCGGGCCCTCCCGCCCCGACAAACCCC
CCGACGCCGGGCGACGATGACGCCAGCGACCAGAATTCGTTCCCCGCCGACGCGAAGCCAGGCTCCAAGTTGCGG
CGGCTCGGAACCATGCTGGGTGGCCGCCGCCGGCAGAGCGTCCATGGCGGTTTCGGGGGGCTGACGCCCCAAAGG
ACTGGCCCGGCCAATTTTGGGCGCCTGGGCAGCAGCCACGGCCGCGTCTCTCCACGGCCGTCGACCAGCAACCTC
AACCAAGACTCGGGCCGACTGTCCGCCCTCGCCGAGACCCCTGACCGGGCCAGCCAAGACGAGACGGCCGCGGAT
CAGAGCAAGCCCGCCCACGAGGGCACCAACGGTGTGACTGCCGGTAGCGACTCGTTACTGGATGCTCCCTCCCCC
GCGGCGGCGGCCGCCCCGGGGATGAACGGGACTCACGCGGCCGACGTCATCGACGATGTTCCTCCCCCGCCGGGG
CCGCCACCGGGCCAGCTGGCCGAAGCACCACCGGCGTTGGCCAAGGACTCGGAGGGCTTCACCGTCCGCGCGCCA
ATGAACGACCCCATCTCCGAGGCCCAGCGCGACGCCGCCGCCGACGAGGCGGACCAGCCCTTCAAGCTCAACATC
CAGAACCAGCCGGTCGAGGAGGAAGACCCCGAGGCCAAGATGGCCGCGCTGTCGAGCGTCGCCAACTCGCTCAAG
GTCGGGCCGGCGACCCGCCGCTCCAGCACCATCAGAGGGCGCCGCGACGTGCGCAACACCATCTACGTGCACACG
CCCACCTCGAGCGTGCGCGAGAGCCAGTCCGACAGCGCGATGCCATCCATTGCCGGCTCCCCGCCCGCCACCTCG
TCGTCTTTCTCCCGCCCGCCCGCCCTCGCCGCGTTGGCGTCCGAGGCCAGCATCGCCGGCACGTCGGACACGCAG
TCGGTGCGGTCCGGCAACTCGCTGGGCAGCCTGCCCCACGCCAAGCATCCCGACATGACGGGCCCGGGCCTGAAC
AGCTCCATCATCGAGACGGTCTCGGCCGTCTTCGAGGGCGGGGTGGTCAAGAGCGCGTCGATTGCGGGCGAGATT
GCCCTGCAGCACAACGCGCCGGATCCGAGTGGTAAGATGCAATCGGTCATCCGGATCAACAACTTTGCGAGCCTC
GAACGCATCGGCCCGAACCGCATCTTCGTCCAAAACTCGTCGTCCGACCAGCCCGACCAGTTCACCGTCGACGTC
TCGCACCTAGCCAGGACCTCCATCGCCTTCTCCTACCGCGTGTTTGCCGAGGAGGCCGAGACGCCCGCCCTCGGC
CGGCACGCGCCGTTGCTGCTGAAGCCGGCCTGGAAGCCGCAGGGCGACAAGCTGGGCCTCCTGCTGCAGTACCAG
CTCAACCCGTCGGCGCAGTTCGCGTCGCCGACGACGCTGCACAACGTCGTCTTCGTTGCCCGGTACGAGGGCAAG
GCCACGAGCGCGCAGACCAAGCCCAGCGGGACGCACCTCAAGGACAAGCACCTGGTCTACTGGCGGCTGGGCGAC
GTGACGCTCACGGGCGACGTGCAGAAGATCGTCTGCCGCATCGCCGGGGCCGACGGCGCGGCGCCGGTCCCCGGG
CACGTCGAGGCTCGATGGGAGTACGCGGCGGCGGGCGGCGAGGCCCGAGGCAGCGGCATCTCCCTCTCGCGGCTG
GACGACGATGGCGACAAGGGCGCCGAGGACGATCCGTTCGCCGACCAGAGCCAGGCGATTGCGGCGGCAGCAGGA
CAGACGTGGGTCGACGTGCCGGCGCAGAGGAGGCTGGTGAGCGGCAAGTACGAGGGCAGGTGA
Gene >Hirsu2|4185
ATGCACAACATCGCCAGCAACCTCGGCGCCATGGCCAAGGACCTGGAGGACGCGCAGGACAAGTCGGAAAAGCTC
AGCCGCAAGGGCGCAAAGGCCAGCGCCCAAAAGGTCGACGCCGCCTCCTCGAGGCTCGAGTCGTCCACGCAGCAG
TGGGAGTCGCAGGCCCCCTTCGTCTTCGAGACGCTGCAGGCCCTGGACGAGTCGCGCGTCAACCAGCTGCGCGAC
CTCCTGACTCAGTACCAGACACACGAGGCCGACCAGGCCCAGCGGGCCCAGAACAACGCCGTCGAGGCCCTGGCC
GCCATGCTCGAGATCAGCACCGAAAAGGAGGTTCGAGACTTCGCCCAGCGCACCACCGGCGCCAAGCCCCCTGCC
AGCACCCGGCCGTCCGTCCGCCGCATGTCGTTCGTGACCGGCGGCGGCGCGCATCCCAGGCAGCCCACCGCGCCC
GACGCCCCATCCTCGCTCCCCGGAGGCCCGACGGACAGCGCAGCCTCCCCGGGCCCTCCCGCCCCGACAAACCCC
CCGACGCCGGGCGACGATGACGCCAGCGACCAGAATTCGTTCCCCGCCGACGCGAAGCCAGGTACACCGACCCCC
GCCGCCCCCCAGAAGGACTCGTGGCCGGACCTAACCGTCTTGCAGGCTCCAAGTTGCGGCGGCTCGGAACCATGC
TGGGTGGCCGCCGCCGGCAGAGCGTCCATGGCGGTTTCGGGGGGCTGACGCCCCAAAGGACTGGCCCGGCCAATT
TTGGGCGCCTGGGCAGCAGCCACGGCCGCGTCTCTCCACGGCCGTCGACCAGCAACCTCAACCAAGACTCGGGCC
GACTGTCCGCCCTCGCCGAGACCCCTGACCGGGCCAGCCAAGACGAGACGGCCGCGGATCAGAGCAAGCCCGCCC
ACGAGGGCACCAACGGTGTGACTGCCGGTAGCGACTCGTTACTGGATGCTCCCTCCCCCGCGGCGGCGGCCGCCC
CGGGGATGAACGGGACTCACGCGGCCGACGTCATCGACGATGTTCCTCCCCCGCCGGGGCCGCCACCGGGCCAGC
TGGCCGAAGCACCACCGGCGTTGGCCAAGGACTCGGAGGGCTTCACCGTCCGCGCGCCAATGAACGACCCCATCT
CCGAGGCCCAGCGCGACGCCGCCGCCGACGAGGCGGACCAGCCCTTCAAGCTCAACATCCAGAACCAGCCGGTCG
AGGAGGAAGACCCCGAGGCCAAGATGGCCGCGCTGTCGAGCGTCGCCAACTCGCTCAAGGTCGGGCCGGCGACCC
GCCGCTCCAGCACCATCAGAGGGCGCCGCGACGTGCGCAACACCATCTACGTGCACACGCCCACCTCGAGCGTGC
GCGAGAGCCAGTCCGACAGCGCGATGCCATCCATTGCCGGCTCCCCGCCCGCCACCTCGTCGTCTTTCTCCCGCC
CGCCCGCCCTCGCCGCGTTGGCGTCCGAGGCCAGCATCGCCGGCACGTCGGACACGCAGTCGGTGCGGTCCGGCA
ACTCGCTGGGCAGCCTGCCCCACGCCAAGCATCCCGACATGACGGGCCCGGGCCTGAACAGCTCCATCATCGAGA
CGGTCTCGGCCGTCTTCGAGGGCGGGGTGGTCAAGAGCGCGTCGATTGCGGGCGAGATTGCCCTGCAGCACAACG
CGCCGGATCCGAGTGGTAAGAGTAGGGACCCCCCCCCCCCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCCA
GGCCCCCTTCCATCTGACGAACCATGTGCGCAGTGCAATCGGTCATCCGGATCAACAACTTTGCGAGCCTCGAAC
GCATCGGCCCGAACCGCATCTTCGTCCAAAACTCGTCGTCCGACCAGCCCGACCAGTTCACCGTCGACGTCTCGC
ACCTAGCCAGGACCTCCATCGCCTTCTCCTACCGCGTGTTTGCCGAGGAGGCCGAGACGCCCGCCCTCGGCCGGC
ACGCGCCGTTGCTGCTGAAGCCGGCCTGGAAGCCGCAGGGCGACAAGCTGGGCCTCCTGCTGCAGTACCAGCTCA
ACCCGTCGGCGCAGTTCGCGTCGCCGACGACGCTGCACAACGTCGTCTTCGTTGCCCGGTACGAGGGCAAGGCCA
CGAGCGCGCAGACCAAGCCCAGCGGGACGCACCTCAAGGACAAGCACCTGGTCTACTGGCGGCTGGGCGACGTGA
CGCTCACGGGCGACGTGCAGAAGATCGTCTGCCGCATCGCCGGGGCCGACGGCGCGGCGCCGGTCCCCGGGCACG
TCGAGGCTCGATGGGAGTACGCGGCGGCGGGCGGCGAGGCCCGAGGCAGCGGCATCTCCCTCTCGCGGCTGGACG
ACGATGGCGACAAGGGCGCCGAGGACGATCCGTTCGCCGACCAGAGCCAGGCGATTGCGGCGGCAGCAGGACAGA
CGTGGGTCGACGTGCCGGCGCAGAGGAGGCTGGTGAGCGGCAAGTACGAGGGCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail