Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4184
Gene name
LocationContig_2154:2527..3475
Strand-
Gene length (bp)948
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 1.6E-22 6 187
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.2E-08 28 191

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 11 269 1.0E-13
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 6 194 3.0E-09
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 8 169 4.0E-08
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 11 253 9.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6082 0.3515 0.1202 0.3047 0.3184 0.0103 0.0541 0.1168 0.0683 0.0199

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup69
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5467
Ophiocordyceps australis 1348a (Ghana) OphauG2|5656
Ophiocordyceps australis 1348a (Ghana) OphauG2|7764
Ophiocordyceps australis map64 (Brazil) OphauB2|1311
Ophiocordyceps australis map64 (Brazil) OphauB2|1430
Ophiocordyceps australis map64 (Brazil) OphauB2|1646
Ophiocordyceps australis map64 (Brazil) OphauB2|4739
Ophiocordyceps camponoti-floridani Ophcf2|01223
Ophiocordyceps camponoti-rufipedis Ophun1|1554
Ophiocordyceps kimflemingae Ophio5|1785
Ophiocordyceps kimflemingae Ophio5|712
Ophiocordyceps subramaniannii Hirsu2|1787
Ophiocordyceps subramaniannii Hirsu2|1856
Ophiocordyceps subramaniannii Hirsu2|4184 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5652
Ophiocordyceps subramaniannii Hirsu2|952

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4184
LAADFAKVDFVGADLSLPDLGLGPARYDELLARADRVIHNAWPVNFNISVASFEPHVRGVRHLVDFAARAAKRVP
VVFVSSISTVMAWPSAAPVPERRIDDLSVAGLGYGRSKLAGSLILDAAAARSGIPAASVRVGQIAGPRGRAGVWN
RQEYLPSLIASSVHLGLLPSHLATGHEVDWTPVEDVAGLILDVAGVTARHAVADITGYFHAVNPARTTWAELAPV
LADYYRGRIKKLVSFEDWLAALKRSGTADLDRNPAAKLVDMYDGMLRAFQAGHGHVNFAMERTMSYSPTVARLGP
ITPDLLRNWCDQWNY*
Coding >Hirsu2|4184
CTGGCCGCCGACTTCGCCAAGGTCGACTTCGTCGGCGCCGACCTGTCGCTCCCGGACCTGGGCCTCGGGCCGGCG
CGGTACGACGAGCTGCTGGCCCGCGCGGACCGGGTGATCCACAACGCGTGGCCCGTCAACTTCAACATCAGCGTC
GCCTCGTTCGAGCCGCACGTGCGCGGCGTGCGGCACCTCGTCGACTTCGCTGCGCGGGCGGCCAAGCGCGTGCCC
GTCGTCTTCGTCTCCAGCATCAGCACCGTCATGGCCTGGCCGTCGGCGGCGCCGGTGCCGGAGCGGCGCATCGAC
GACCTCTCCGTCGCCGGCCTGGGCTACGGCCGCTCCAAGCTGGCCGGCAGCCTGATCCTGGACGCGGCCGCCGCC
CGGTCCGGCATCCCCGCGGCGTCGGTCCGGGTCGGGCAGATCGCGGGGCCGCGCGGCCGCGCCGGCGTCTGGAAC
CGGCAGGAGTACCTGCCGTCGCTCATCGCCAGCTCCGTCCACCTCGGCCTCCTGCCGTCGCACCTGGCGACCGGG
CACGAGGTCGACTGGACGCCCGTCGAGGACGTGGCCGGCCTGATCCTCGACGTCGCGGGCGTCACGGCCCGGCAC
GCCGTCGCCGACATCACCGGCTACTTCCACGCCGTCAACCCGGCCCGCACGACGTGGGCCGAGCTGGCGCCCGTG
CTGGCCGACTACTACCGCGGCCGCATCAAGAAGCTCGTCAGCTTCGAGGACTGGCTCGCCGCGCTCAAGCGCAGC
GGCACCGCCGACCTGGACCGGAACCCGGCCGCCAAGCTGGTCGACATGTACGACGGCATGCTGCGGGCCTTCCAG
GCAGGGCACGGCCACGTCAACTTCGCCATGGAGAGGACCATGAGCTACAGCCCGACCGTGGCCCGTCTCGGGCCC
ATCACCCCGGACCTGCTCAGGAACTGGTGCGATCAGTGGAACTACTGA
Transcript >Hirsu2|4184
CTGGCCGCCGACTTCGCCAAGGTCGACTTCGTCGGCGCCGACCTGTCGCTCCCGGACCTGGGCCTCGGGCCGGCG
CGGTACGACGAGCTGCTGGCCCGCGCGGACCGGGTGATCCACAACGCGTGGCCCGTCAACTTCAACATCAGCGTC
GCCTCGTTCGAGCCGCACGTGCGCGGCGTGCGGCACCTCGTCGACTTCGCTGCGCGGGCGGCCAAGCGCGTGCCC
GTCGTCTTCGTCTCCAGCATCAGCACCGTCATGGCCTGGCCGTCGGCGGCGCCGGTGCCGGAGCGGCGCATCGAC
GACCTCTCCGTCGCCGGCCTGGGCTACGGCCGCTCCAAGCTGGCCGGCAGCCTGATCCTGGACGCGGCCGCCGCC
CGGTCCGGCATCCCCGCGGCGTCGGTCCGGGTCGGGCAGATCGCGGGGCCGCGCGGCCGCGCCGGCGTCTGGAAC
CGGCAGGAGTACCTGCCGTCGCTCATCGCCAGCTCCGTCCACCTCGGCCTCCTGCCGTCGCACCTGGCGACCGGG
CACGAGGTCGACTGGACGCCCGTCGAGGACGTGGCCGGCCTGATCCTCGACGTCGCGGGCGTCACGGCCCGGCAC
GCCGTCGCCGACATCACCGGCTACTTCCACGCCGTCAACCCGGCCCGCACGACGTGGGCCGAGCTGGCGCCCGTG
CTGGCCGACTACTACCGCGGCCGCATCAAGAAGCTCGTCAGCTTCGAGGACTGGCTCGCCGCGCTCAAGCGCAGC
GGCACCGCCGACCTGGACCGGAACCCGGCCGCCAAGCTGGTCGACATGTACGACGGCATGCTGCGGGCCTTCCAG
GCAGGGCACGGCCACGTCAACTTCGCCATGGAGAGGACCATGAGCTACAGCCCGACCGTGGCCCGTCTCGGGCCC
ATCACCCCGGACCTGCTCAGGAACTGGTGCGATCAGTGGAACTACTGA
Gene >Hirsu2|4184
CTGGCCGCCGACTTCGCCAAGGTCGACTTCGTCGGCGCCGACCTGTCGCTCCCGGACCTGGGCCTCGGGCCGGCG
CGGTACGACGAGCTGCTGGCCCGCGCGGACCGGGTGATCCACAACGCGTGGCCCGTCAACTTCAACATCAGCGTC
GCCTCGTTCGAGCCGCACGTGCGCGGCGTGCGGCACCTCGTCGACTTCGCTGCGCGGGCGGCCAAGCGCGTGCCC
GTCGTCTTCGTCTCCAGCATCAGCACCGTCATGGCCTGGCCGTCGGCGGCGCCGGTGCCGGAGCGGCGCATCGAC
GACCTCTCCGTCGCCGGCCTGGGCTACGGCCGCTCCAAGCTGGCCGGCAGCCTGATCCTGGACGCGGCCGCCGCC
CGGTCCGGCATCCCCGCGGCGTCGGTCCGGGTCGGGCAGATCGCGGGGCCGCGCGGCCGCGCCGGCGTCTGGAAC
CGGCAGGAGTACCTGCCGTCGCTCATCGCCAGCTCCGTCCACCTCGGCCTCCTGCCGTCGCACCTGGCGACCGGG
CACGAGGTCGACTGGACGCCCGTCGAGGACGTGGCCGGCCTGATCCTCGACGTCGCGGGCGTCACGGCCCGGCAC
GCCGTCGCCGACATCACCGGCTACTTCCACGCCGTCAACCCGGCCCGCACGACGTGGGCCGAGCTGGCGCCCGTG
CTGGCCGACTACTACCGCGGCCGCATCAAGAAGCTCGTCAGCTTCGAGGACTGGCTCGCCGCGCTCAAGCGCAGC
GGCACCGCCGACCTGGACCGGAACCCGGCCGCCAAGCTGGTCGACATGTACGACGGCATGCTGCGGGCCTTCCAG
GCAGGGCACGGCCACGTCAACTTCGCCATGGAGAGGACCATGAGCTACAGCCCGACCGTGGCCCGTCTCGGGCCC
ATCACCCCGGACCTGCTCAGGAACTGGTGCGATCAGTGGAACTACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail