Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4184
Gene name
LocationContig_2154:2527..3475
Strand-
Gene length (bp)948
Transcript length (bp)948
Coding sequence length (bp)948
Protein length (aa) 316

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 1.6E-22 6 187
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.2E-08 28 191

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 11 269 1.0E-13
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 6 194 3.0E-09
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 8 169 4.0E-08
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 11 253 9.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4184
LAADFAKVDFVGADLSLPDLGLGPARYDELLARADRVIHNAWPVNFNISVASFEPHVRGVRHLVDFAARAAKRVP
VVFVSSISTVMAWPSAAPVPERRIDDLSVAGLGYGRSKLAGSLILDAAAARSGIPAASVRVGQIAGPRGRAGVWN
RQEYLPSLIASSVHLGLLPSHLATGHEVDWTPVEDVAGLILDVAGVTARHAVADITGYFHAVNPARTTWAELAPV
LADYYRGRIKKLVSFEDWLAALKRSGTADLDRNPAAKLVDMYDGMLRAFQAGHGHVNFAMERTMSYSPTVARLGP
ITPDLLRNWCDQWNY*
Coding >Hirsu2|4184
CTGGCCGCCGACTTCGCCAAGGTCGACTTCGTCGGCGCCGACCTGTCGCTCCCGGACCTGGGCCTCGGGCCGGCG
CGGTACGACGAGCTGCTGGCCCGCGCGGACCGGGTGATCCACAACGCGTGGCCCGTCAACTTCAACATCAGCGTC
GCCTCGTTCGAGCCGCACGTGCGCGGCGTGCGGCACCTCGTCGACTTCGCTGCGCGGGCGGCCAAGCGCGTGCCC
GTCGTCTTCGTCTCCAGCATCAGCACCGTCATGGCCTGGCCGTCGGCGGCGCCGGTGCCGGAGCGGCGCATCGAC
GACCTCTCCGTCGCCGGCCTGGGCTACGGCCGCTCCAAGCTGGCCGGCAGCCTGATCCTGGACGCGGCCGCCGCC
CGGTCCGGCATCCCCGCGGCGTCGGTCCGGGTCGGGCAGATCGCGGGGCCGCGCGGCCGCGCCGGCGTCTGGAAC
CGGCAGGAGTACCTGCCGTCGCTCATCGCCAGCTCCGTCCACCTCGGCCTCCTGCCGTCGCACCTGGCGACCGGG
CACGAGGTCGACTGGACGCCCGTCGAGGACGTGGCCGGCCTGATCCTCGACGTCGCGGGCGTCACGGCCCGGCAC
GCCGTCGCCGACATCACCGGCTACTTCCACGCCGTCAACCCGGCCCGCACGACGTGGGCCGAGCTGGCGCCCGTG
CTGGCCGACTACTACCGCGGCCGCATCAAGAAGCTCGTCAGCTTCGAGGACTGGCTCGCCGCGCTCAAGCGCAGC
GGCACCGCCGACCTGGACCGGAACCCGGCCGCCAAGCTGGTCGACATGTACGACGGCATGCTGCGGGCCTTCCAG
GCAGGGCACGGCCACGTCAACTTCGCCATGGAGAGGACCATGAGCTACAGCCCGACCGTGGCCCGTCTCGGGCCC
ATCACCCCGGACCTGCTCAGGAACTGGTGCGATCAGTGGAACTACTGA
Transcript >Hirsu2|4184
CTGGCCGCCGACTTCGCCAAGGTCGACTTCGTCGGCGCCGACCTGTCGCTCCCGGACCTGGGCCTCGGGCCGGCG
CGGTACGACGAGCTGCTGGCCCGCGCGGACCGGGTGATCCACAACGCGTGGCCCGTCAACTTCAACATCAGCGTC
GCCTCGTTCGAGCCGCACGTGCGCGGCGTGCGGCACCTCGTCGACTTCGCTGCGCGGGCGGCCAAGCGCGTGCCC
GTCGTCTTCGTCTCCAGCATCAGCACCGTCATGGCCTGGCCGTCGGCGGCGCCGGTGCCGGAGCGGCGCATCGAC
GACCTCTCCGTCGCCGGCCTGGGCTACGGCCGCTCCAAGCTGGCCGGCAGCCTGATCCTGGACGCGGCCGCCGCC
CGGTCCGGCATCCCCGCGGCGTCGGTCCGGGTCGGGCAGATCGCGGGGCCGCGCGGCCGCGCCGGCGTCTGGAAC
CGGCAGGAGTACCTGCCGTCGCTCATCGCCAGCTCCGTCCACCTCGGCCTCCTGCCGTCGCACCTGGCGACCGGG
CACGAGGTCGACTGGACGCCCGTCGAGGACGTGGCCGGCCTGATCCTCGACGTCGCGGGCGTCACGGCCCGGCAC
GCCGTCGCCGACATCACCGGCTACTTCCACGCCGTCAACCCGGCCCGCACGACGTGGGCCGAGCTGGCGCCCGTG
CTGGCCGACTACTACCGCGGCCGCATCAAGAAGCTCGTCAGCTTCGAGGACTGGCTCGCCGCGCTCAAGCGCAGC
GGCACCGCCGACCTGGACCGGAACCCGGCCGCCAAGCTGGTCGACATGTACGACGGCATGCTGCGGGCCTTCCAG
GCAGGGCACGGCCACGTCAACTTCGCCATGGAGAGGACCATGAGCTACAGCCCGACCGTGGCCCGTCTCGGGCCC
ATCACCCCGGACCTGCTCAGGAACTGGTGCGATCAGTGGAACTACTGA
Gene >Hirsu2|4184
CTGGCCGCCGACTTCGCCAAGGTCGACTTCGTCGGCGCCGACCTGTCGCTCCCGGACCTGGGCCTCGGGCCGGCG
CGGTACGACGAGCTGCTGGCCCGCGCGGACCGGGTGATCCACAACGCGTGGCCCGTCAACTTCAACATCAGCGTC
GCCTCGTTCGAGCCGCACGTGCGCGGCGTGCGGCACCTCGTCGACTTCGCTGCGCGGGCGGCCAAGCGCGTGCCC
GTCGTCTTCGTCTCCAGCATCAGCACCGTCATGGCCTGGCCGTCGGCGGCGCCGGTGCCGGAGCGGCGCATCGAC
GACCTCTCCGTCGCCGGCCTGGGCTACGGCCGCTCCAAGCTGGCCGGCAGCCTGATCCTGGACGCGGCCGCCGCC
CGGTCCGGCATCCCCGCGGCGTCGGTCCGGGTCGGGCAGATCGCGGGGCCGCGCGGCCGCGCCGGCGTCTGGAAC
CGGCAGGAGTACCTGCCGTCGCTCATCGCCAGCTCCGTCCACCTCGGCCTCCTGCCGTCGCACCTGGCGACCGGG
CACGAGGTCGACTGGACGCCCGTCGAGGACGTGGCCGGCCTGATCCTCGACGTCGCGGGCGTCACGGCCCGGCAC
GCCGTCGCCGACATCACCGGCTACTTCCACGCCGTCAACCCGGCCCGCACGACGTGGGCCGAGCTGGCGCCCGTG
CTGGCCGACTACTACCGCGGCCGCATCAAGAAGCTCGTCAGCTTCGAGGACTGGCTCGCCGCGCTCAAGCGCAGC
GGCACCGCCGACCTGGACCGGAACCCGGCCGCCAAGCTGGTCGACATGTACGACGGCATGCTGCGGGCCTTCCAG
GCAGGGCACGGCCACGTCAACTTCGCCATGGAGAGGACCATGAGCTACAGCCCGACCGTGGCCCGTCTCGGGCCC
ATCACCCCGGACCTGCTCAGGAACTGGTGCGATCAGTGGAACTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail