Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4181
Gene name
LocationContig_2151:1023..2592
Strand+
Gene length (bp)1569
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00221 Lyase_aromatic Aromatic amino acid lyase 4.3E-171 13 474

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8U8Z7|HUTH_AGRFC Histidine ammonia-lyase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hutH PE=3 SV=1 2 515 0.0E+00
sp|Q9KWE4|HUTH_AGRRH Histidine ammonia-lyase OS=Agrobacterium rhizogenes GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|A6WYU8|HUTH_OCHA4 Histidine ammonia-lyase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|Q8FVB4|HUTH_BRUSU Histidine ammonia-lyase OS=Brucella suis biovar 1 (strain 1330) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|Q579E8|HUTH_BRUAB Histidine ammonia-lyase OS=Brucella abortus biovar 1 (strain 9-941) GN=hutH PE=3 SV=1 4 515 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8U8Z7|HUTH_AGRFC Histidine ammonia-lyase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hutH PE=3 SV=1 2 515 0.0E+00
sp|Q9KWE4|HUTH_AGRRH Histidine ammonia-lyase OS=Agrobacterium rhizogenes GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|A6WYU8|HUTH_OCHA4 Histidine ammonia-lyase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|Q8FVB4|HUTH_BRUSU Histidine ammonia-lyase OS=Brucella suis biovar 1 (strain 1330) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|Q579E8|HUTH_BRUAB Histidine ammonia-lyase OS=Brucella abortus biovar 1 (strain 9-941) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|Q2YIL6|HUTH_BRUA2 Histidine ammonia-lyase OS=Brucella abortus (strain 2308) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|B2SD96|HUTH_BRUA1 Histidine ammonia-lyase OS=Brucella abortus (strain S19) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|O31197|HUTH_RHIME Histidine ammonia-lyase OS=Rhizobium meliloti (strain 1021) GN=hutH PE=2 SV=2 4 516 0.0E+00
sp|A9WVU3|HUTH_BRUSI Histidine ammonia-lyase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|A9MCL0|HUTH_BRUC2 Histidine ammonia-lyase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|A5VVJ6|HUTH_BRUO2 Histidine ammonia-lyase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|Q11E18|HUTH_CHESB Histidine ammonia-lyase OS=Chelativorans sp. (strain BNC1) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|B9JDC0|HUTH_AGRRK Histidine ammonia-lyase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|Q8YD09|HUTIH_BRUME Bifunctional imidazolonepropionase/histidine ammonia-lyase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hutIH PE=3 SV=2 4 515 0.0E+00
sp|Q6G3U8|HUTH_BARHE Histidine ammonia-lyase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=hutH PE=3 SV=1 4 514 0.0E+00
sp|B9K288|HUTH_AGRVS Histidine ammonia-lyase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=hutH PE=3 SV=1 58 515 0.0E+00
sp|A9IVW5|HUTH_BART1 Histidine ammonia-lyase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=hutH PE=3 SV=1 4 514 0.0E+00
sp|Q6FZP9|HUTH_BARQU Histidine ammonia-lyase OS=Bartonella quintana (strain Toulouse) GN=hutH PE=3 SV=1 4 515 0.0E+00
sp|A1AZX9|HUTH_PARDP Histidine ammonia-lyase OS=Paracoccus denitrificans (strain Pd 1222) GN=hutH PE=3 SV=1 7 511 0.0E+00
sp|Q162E2|HUTH_ROSDO Histidine ammonia-lyase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hutH PE=3 SV=1 4 517 0.0E+00
sp|Q5LRD8|HUTH_RUEPO Histidine ammonia-lyase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hutH PE=3 SV=1 2 506 0.0E+00
sp|A5EQB7|HUTH_BRASB Histidine ammonia-lyase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=hutH PE=3 SV=1 2 510 0.0E+00
sp|B9KSW6|HUTH_RHOSK Histidine ammonia-lyase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hutH PE=3 SV=1 7 505 0.0E+00
sp|Q3J289|HUTH_RHOS4 Histidine ammonia-lyase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hutH PE=3 SV=1 7 505 0.0E+00
sp|Q8PLZ8|HUTH_XANAC Histidine ammonia-lyase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hutH PE=3 SV=1 4 506 0.0E+00
sp|A3PK23|HUTH_RHOS1 Histidine ammonia-lyase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=hutH PE=3 SV=1 7 505 0.0E+00
sp|B8II08|HUTH_METNO Histidine ammonia-lyase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=hutH PE=3 SV=1 2 517 0.0E+00
sp|Q8PAA7|HUTH_XANCP Histidine ammonia-lyase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hutH PE=3 SV=1 1 506 0.0E+00
sp|B0RUX3|HUTH_XANCB Histidine ammonia-lyase OS=Xanthomonas campestris pv. campestris (strain B100) GN=hutH PE=3 SV=1 1 506 0.0E+00
sp|Q4UTB9|HUTH_XANC8 Histidine ammonia-lyase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hutH PE=3 SV=1 1 506 0.0E+00
sp|Q0AP92|HUTH_MARMM Histidine ammonia-lyase OS=Maricaulis maris (strain MCS10) GN=hutH PE=3 SV=1 2 512 0.0E+00
sp|A5FZB9|HUTH_ACICJ Histidine ammonia-lyase OS=Acidiphilium cryptum (strain JF-5) GN=hutH PE=3 SV=1 9 515 0.0E+00
sp|A4YNK7|HUTH_BRASO Histidine ammonia-lyase OS=Bradyrhizobium sp. (strain ORS278) GN=hutH PE=3 SV=1 58 486 2.0E-180
sp|Q983I0|HUTH_RHILO Histidine ammonia-lyase OS=Rhizobium loti (strain MAFF303099) GN=hutH PE=3 SV=1 2 514 5.0E-180
sp|B4RED8|HUTH_PHEZH Histidine ammonia-lyase OS=Phenylobacterium zucineum (strain HLK1) GN=hutH PE=3 SV=1 2 502 2.0E-179
sp|B0SYU6|HUTH_CAUSK Histidine ammonia-lyase OS=Caulobacter sp. (strain K31) GN=hutH PE=3 SV=1 7 515 8.0E-179
sp|Q0BZK2|HUTH_HYPNA Histidine ammonia-lyase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hutH PE=3 SV=1 2 507 9.0E-178
sp|Q1GSH0|HUTH_SPHAL Histidine ammonia-lyase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=hutH PE=3 SV=1 5 506 3.0E-177
sp|B0UQ15|HUTH_METS4 Histidine ammonia-lyase OS=Methylobacterium sp. (strain 4-46) GN=hutH PE=3 SV=1 2 505 9.0E-175
sp|P58082|HUTH_CAUCR Histidine ammonia-lyase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hutH PE=3 SV=1 7 512 2.0E-174
sp|B8H2S1|HUTH_CAUCN Histidine ammonia-lyase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hutH PE=3 SV=1 7 512 2.0E-174
sp|A5WDR1|HUTH_PSYWF Histidine ammonia-lyase OS=Psychrobacter sp. (strain PRwf-1) GN=hutH PE=3 SV=1 4 502 8.0E-174
sp|Q8XW29|HUTH_RALSO Histidine ammonia-lyase OS=Ralstonia solanacearum (strain GMI1000) GN=hutH PE=3 SV=2 3 502 1.0E-173
sp|Q2RUU3|HUTH_RHORT Histidine ammonia-lyase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hutH PE=3 SV=1 7 502 6.0E-171
sp|Q89GV3|HUTH_BRADU Histidine ammonia-lyase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hutH PE=3 SV=1 58 513 3.0E-169
sp|Q5FRR8|HUTH_GLUOX Histidine ammonia-lyase OS=Gluconobacter oxydans (strain 621H) GN=hutH PE=3 SV=1 7 515 6.0E-167
sp|Q7P188|HUTH_CHRVO Histidine ammonia-lyase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hutH PE=3 SV=1 5 514 4.0E-166
sp|B4EDX5|HUTH_BURCJ Histidine ammonia-lyase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hutH PE=3 SV=1 5 497 2.0E-165
sp|Q1Q9E4|HUTH_PSYCK Histidine ammonia-lyase OS=Psychrobacter cryohalolentis (strain K5) GN=hutH PE=3 SV=1 2 502 1.0E-164
sp|Q8EKJ4|HUTH_SHEON Histidine ammonia-lyase OS=Shewanella oneidensis (strain MR-1) GN=hutH PE=3 SV=1 7 514 3.0E-163
sp|Q63SH6|HUTH_BURPS Histidine ammonia-lyase OS=Burkholderia pseudomallei (strain K96243) GN=hutH PE=3 SV=1 5 491 9.0E-163
sp|A3NXA3|HUTH_BURP0 Histidine ammonia-lyase OS=Burkholderia pseudomallei (strain 1106a) GN=hutH PE=3 SV=1 5 491 9.0E-163
sp|Q39EP0|HUTH_BURL3 Histidine ammonia-lyase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hutH PE=3 SV=1 5 497 1.0E-162
sp|Q62LJ6|HUTH_BURMA Histidine ammonia-lyase OS=Burkholderia mallei (strain ATCC 23344) GN=hutH PE=3 SV=2 5 491 1.0E-162
sp|A2SA96|HUTH_BURM9 Histidine ammonia-lyase OS=Burkholderia mallei (strain NCTC 10229) GN=hutH PE=3 SV=1 5 491 1.0E-162
sp|A3MLT7|HUTH_BURM7 Histidine ammonia-lyase OS=Burkholderia mallei (strain NCTC 10247) GN=hutH PE=3 SV=1 5 491 1.0E-162
sp|A8G1S5|HUTH_SHESH Histidine ammonia-lyase OS=Shewanella sediminis (strain HAW-EB3) GN=hutH PE=3 SV=1 7 514 3.0E-162
sp|A3NBH0|HUTH_BURP6 Histidine ammonia-lyase OS=Burkholderia pseudomallei (strain 668) GN=hutH PE=3 SV=1 5 491 6.0E-162
sp|B1KP55|HUTH_SHEWM Histidine ammonia-lyase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=hutH PE=3 SV=1 7 514 6.0E-161
sp|Q5E0C6|HUTH_VIBF1 Histidine ammonia-lyase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hutH PE=3 SV=1 4 514 1.0E-160
sp|B5ETN1|HUTH_VIBFM Histidine ammonia-lyase OS=Vibrio fischeri (strain MJ11) GN=hutH PE=3 SV=1 4 514 3.0E-160
sp|Q88CZ7|HUTH_PSEPK Histidine ammonia-lyase OS=Pseudomonas putida (strain KT2440) GN=hutH PE=3 SV=1 2 514 5.0E-160
sp|B2T2Y2|HUTH_BURPP Histidine ammonia-lyase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=hutH PE=3 SV=1 5 504 6.0E-160
sp|B6IWC6|HUTH_RHOCS Histidine ammonia-lyase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=hutH PE=3 SV=1 1 507 1.0E-159
sp|Q9KSQ4|HUTH_VIBCH Histidine ammonia-lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hutH PE=3 SV=1 9 513 3.0E-159
sp|Q0BDK6|HUTH_BURCM Histidine ammonia-lyase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hutH PE=3 SV=1 5 498 3.0E-159
sp|B1YT80|HUTH_BURA4 Histidine ammonia-lyase OS=Burkholderia ambifaria (strain MC40-6) GN=hutH PE=3 SV=1 5 505 3.0E-159
sp|A8AJ15|HUTH_CITK8 Histidine ammonia-lyase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=hutH PE=3 SV=1 2 508 7.0E-159
sp|Q6AKP3|HUTH_DESPS Histidine ammonia-lyase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hutH PE=3 SV=1 1 515 4.0E-158
sp|B1JV50|HUTH_BURCC Histidine ammonia-lyase OS=Burkholderia cenocepacia (strain MC0-3) GN=hutH PE=3 SV=1 5 497 6.0E-158
sp|A9H863|HUTH_GLUDA Histidine ammonia-lyase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=hutH PE=3 SV=1 1 500 1.0E-157
sp|A8HA91|HUTH_SHEPA Histidine ammonia-lyase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=hutH PE=3 SV=1 7 514 1.0E-157
sp|A4JG46|HUTH_BURVG Histidine ammonia-lyase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hutH PE=3 SV=1 5 497 2.0E-157
sp|A4W8B5|HUTH_ENT38 Histidine ammonia-lyase OS=Enterobacter sp. (strain 638) GN=hutH PE=3 SV=1 2 503 2.0E-157
sp|Q3KJE6|HUTH_PSEPF Histidine ammonia-lyase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hutH PE=3 SV=1 2 514 2.0E-157
sp|Q7N296|HUTH_PHOLL Histidine ammonia-lyase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hutH PE=3 SV=1 2 502 3.0E-157
sp|P21310|HUTH_PSEPU Histidine ammonia-lyase OS=Pseudomonas putida GN=hutH PE=1 SV=3 2 514 3.0E-157
sp|Q6LQ56|HUTH_PHOPR Histidine ammonia-lyase OS=Photobacterium profundum GN=hutH PE=3 SV=1 5 514 3.0E-157
sp|Q15X40|HUTH_PSEA6 Histidine ammonia-lyase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hutH PE=3 SV=1 7 510 6.0E-157
sp|Q87UM1|HUTH_PSESM Histidine ammonia-lyase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hutH PE=3 SV=1 4 514 2.0E-155
sp|B5XZ79|HUTH_KLEP3 Histidine ammonia-lyase OS=Klebsiella pneumoniae (strain 342) GN=hutH PE=3 SV=1 2 504 2.0E-155
sp|B8CGY5|HUTH_SHEPW Histidine ammonia-lyase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=hutH PE=3 SV=1 7 513 9.0E-155
sp|Q8VMR3|HUTH_PSEFS Histidine ammonia-lyase OS=Pseudomonas fluorescens (strain SBW25) GN=hutH PE=3 SV=2 4 514 1.0E-154
sp|A6T6L1|HUTH_KLEP7 Histidine ammonia-lyase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hutH PE=3 SV=1 2 504 2.0E-154
sp|Q5QV30|HUTH_IDILO Histidine ammonia-lyase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hutH PE=3 SV=1 2 506 3.0E-154
sp|Q87Q77|HUTH_VIBPA Histidine ammonia-lyase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hutH PE=3 SV=1 4 497 8.0E-154
sp|Q5NZX8|HUTH_AROAE Histidine ammonia-lyase OS=Aromatoleum aromaticum (strain EbN1) GN=hutH PE=3 SV=1 2 504 1.0E-153
sp|B4TQT6|HUTH_SALSV Histidine ammonia-lyase OS=Salmonella schwarzengrund (strain CVM19633) GN=hutH PE=3 SV=1 2 508 1.0E-153
sp|B4TC45|HUTH_SALHS Histidine ammonia-lyase OS=Salmonella heidelberg (strain SL476) GN=hutH PE=3 SV=1 2 508 2.0E-153
sp|B5QX62|HUTH_SALEP Histidine ammonia-lyase OS=Salmonella enteritidis PT4 (strain P125109) GN=hutH PE=3 SV=1 2 508 2.0E-153
sp|B5FP58|HUTH_SALDC Histidine ammonia-lyase OS=Salmonella dublin (strain CT_02021853) GN=hutH PE=3 SV=1 2 508 2.0E-153
sp|C0PWX9|HUTH_SALPC Histidine ammonia-lyase OS=Salmonella paratyphi C (strain RKS4594) GN=hutH PE=3 SV=1 2 508 3.0E-153
sp|B4SZJ4|HUTH_SALNS Histidine ammonia-lyase OS=Salmonella newport (strain SL254) GN=hutH PE=3 SV=1 2 508 3.0E-153
sp|Q8ZQQ9|HUTH_SALTY Histidine ammonia-lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hutH PE=3 SV=1 2 508 4.0E-153
sp|A1STQ3|HUTH_PSYIN Histidine ammonia-lyase OS=Psychromonas ingrahamii (strain 37) GN=hutH PE=3 SV=1 9 514 4.0E-153
sp|Q57RG6|HUTH_SALCH Histidine ammonia-lyase OS=Salmonella choleraesuis (strain SC-B67) GN=hutH PE=3 SV=1 2 508 5.0E-153
sp|A9AGP7|HUTH_BURM1 Histidine ammonia-lyase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hutH PE=3 SV=1 5 497 2.0E-152
sp|A0K8U6|HUTH_BURCH Histidine ammonia-lyase OS=Burkholderia cenocepacia (strain HI2424) GN=hutH PE=3 SV=1 5 497 2.0E-152
sp|Q1BHY5|HUTH_BURCA Histidine ammonia-lyase OS=Burkholderia cenocepacia (strain AU 1054) GN=hutH PE=3 SV=1 5 497 2.0E-152
sp|A9MTJ1|HUTH_SALPB Histidine ammonia-lyase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=hutH PE=3 SV=1 2 508 2.0E-152
sp|A9MJE9|HUTH_SALAR Histidine ammonia-lyase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=hutH PE=3 SV=1 5 508 3.0E-152
sp|B5R758|HUTH_SALG2 Histidine ammonia-lyase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=hutH PE=3 SV=1 2 508 4.0E-152
sp|B5F069|HUTH_SALA4 Histidine ammonia-lyase OS=Salmonella agona (strain SL483) GN=hutH PE=3 SV=1 2 508 5.0E-152
sp|Q8Z896|HUTH_SALTI Histidine ammonia-lyase OS=Salmonella typhi GN=hutH PE=3 SV=1 2 508 5.0E-152
sp|Q8DA21|HUTH_VIBVU Histidine ammonia-lyase OS=Vibrio vulnificus (strain CMCP6) GN=hutH PE=3 SV=1 4 497 1.0E-151
sp|B5BC34|HUTH_SALPK Histidine ammonia-lyase OS=Salmonella paratyphi A (strain AKU_12601) GN=hutH PE=3 SV=1 2 508 1.0E-151
sp|Q5PG61|HUTH_SALPA Histidine ammonia-lyase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hutH PE=3 SV=1 2 508 1.0E-151
sp|Q7MK58|HUTH_VIBVY Histidine ammonia-lyase OS=Vibrio vulnificus (strain YJ016) GN=hutH PE=3 SV=1 4 497 3.0E-151
sp|Q02ER8|HUTH_PSEAB Histidine ammonia-lyase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hutH PE=3 SV=1 4 514 6.0E-150
sp|Q9HU85|HUTH_PSEAE Histidine ammonia-lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hutH PE=3 SV=1 4 514 9.0E-150
sp|B7V3J1|HUTH_PSEA8 Histidine ammonia-lyase OS=Pseudomonas aeruginosa (strain LESB58) GN=hutH PE=3 SV=1 4 514 9.0E-150
sp|A1JSW6|HUTH_YERE8 Histidine ammonia-lyase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=hutH PE=3 SV=1 5 514 4.0E-148
sp|Q664B8|HUTH_YERPS Histidine ammonia-lyase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hutH PE=3 SV=1 2 514 4.0E-146
sp|Q8ZA10|HUTH_YERPE Histidine ammonia-lyase OS=Yersinia pestis GN=hutH PE=3 SV=1 2 514 6.0E-146
sp|Q5ZVR0|HUTH_LEGPH Histidine ammonia-lyase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hutH PE=3 SV=2 1 490 5.0E-144
sp|Q5X5I5|HUTH_LEGPA Histidine ammonia-lyase OS=Legionella pneumophila (strain Paris) GN=hutH PE=3 SV=1 7 490 9.0E-144
sp|A1TRE4|HUTH_ACIAC Histidine ammonia-lyase OS=Acidovorax citrulli (strain AAC00-1) GN=hutH PE=3 SV=1 2 499 2.0E-143
sp|A5IBM2|HUTH_LEGPC Histidine ammonia-lyase OS=Legionella pneumophila (strain Corby) GN=hutH PE=3 SV=1 7 490 4.0E-143
sp|Q5WWW8|HUTH_LEGPL Histidine ammonia-lyase OS=Legionella pneumophila (strain Lens) GN=hutH PE=3 SV=1 58 490 3.0E-141
sp|Q1D6R1|HUTH_MYXXD Histidine ammonia-lyase OS=Myxococcus xanthus (strain DK 1622) GN=hutH PE=3 SV=1 3 506 3.0E-133
sp|A8MF64|HUTH_ALKOO Histidine ammonia-lyase OS=Alkaliphilus oremlandii (strain OhILAs) GN=hutH PE=3 SV=1 7 510 7.0E-131
sp|Q93TX3|HUTH_STIAU Histidine ammonia-lyase OS=Stigmatella aurantiaca GN=hutH PE=3 SV=1 49 506 9.0E-131
sp|Q9RZ06|HUTH_DEIRA Histidine ammonia-lyase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hutH PE=3 SV=1 58 504 1.0E-130
sp|B2A3D9|HUTH_NATTJ Histidine ammonia-lyase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=hutH PE=3 SV=1 58 510 7.0E-128
sp|C1CWB4|HUTH_DEIDV Histidine ammonia-lyase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=hutH PE=3 SV=1 58 508 8.0E-125
sp|B8J950|HUTH_ANAD2 Histidine ammonia-lyase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=hutH PE=3 SV=1 37 502 1.0E-124
sp|B4UC43|HUTH_ANASK Histidine ammonia-lyase OS=Anaeromyxobacter sp. (strain K) GN=hutH PE=3 SV=1 37 502 1.0E-124
sp|Q2IIV4|HUTH_ANADE Histidine ammonia-lyase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=hutH PE=3 SV=1 37 502 5.0E-124
sp|Q1IRT8|HUTH_KORVE Histidine ammonia-lyase OS=Koribacter versatilis (strain Ellin345) GN=hutH PE=3 SV=1 58 505 3.0E-123
sp|Q67JH4|HUTH_SYMTH Histidine ammonia-lyase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hutH PE=3 SV=1 12 507 5.0E-123
sp|A6TSX0|HUTH_ALKMQ Histidine ammonia-lyase OS=Alkaliphilus metalliredigens (strain QYMF) GN=hutH PE=3 SV=1 2 507 7.0E-123
sp|A9GFW6|HUTH_SORC5 Histidine ammonia-lyase OS=Sorangium cellulosum (strain So ce56) GN=hutH PE=3 SV=1 58 512 3.0E-122
sp|Q5WAZ6|HUTH_BACSK Histidine ammonia-lyase OS=Bacillus clausii (strain KSM-K16) GN=hutH PE=3 SV=1 12 500 3.0E-121
sp|Q7NCB3|HUTH_GLOVI Histidine ammonia-lyase OS=Gloeobacter violaceus (strain PCC 7421) GN=hutH PE=3 SV=1 27 507 5.0E-121
sp|C5D4K1|HUTH_GEOSW Histidine ammonia-lyase OS=Geobacillus sp. (strain WCH70) GN=hutH PE=3 SV=1 58 497 1.0E-119
sp|A4IK90|HUTH_GEOTN Histidine ammonia-lyase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hutH PE=3 SV=1 58 492 2.0E-119
sp|Q8RBH4|HUTH_CALS4 Histidine ammonia-lyase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hutH PE=3 SV=1 40 511 4.0E-119
sp|Q73Q56|HUTH_TREDE Histidine ammonia-lyase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=hutH PE=3 SV=1 12 508 1.0E-117
sp|P10944|HUTH_BACSU Histidine ammonia-lyase OS=Bacillus subtilis (strain 168) GN=hutH PE=2 SV=1 58 503 1.0E-117
sp|A7ZAE4|HUTH_BACMF Histidine ammonia-lyase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hutH PE=3 SV=2 58 490 2.0E-116
sp|Q5L310|HUTH_GEOKA Histidine ammonia-lyase OS=Geobacillus kaustophilus (strain HTA426) GN=hutH PE=3 SV=1 15 492 6.0E-116
sp|Q9KBE6|HUTH_BACHD Histidine ammonia-lyase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hutH PE=3 SV=1 58 500 2.0E-115
sp|Q733H8|HUTH_BACC1 Histidine ammonia-lyase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hutH PE=3 SV=1 58 490 6.0E-115
sp|B7JI80|HUTH_BACC0 Histidine ammonia-lyase OS=Bacillus cereus (strain AH820) GN=hutH PE=3 SV=1 31 504 8.0E-115
sp|Q81Y45|HUTH_BACAN Histidine ammonia-lyase OS=Bacillus anthracis GN=hutH PE=3 SV=1 31 504 1.0E-114
sp|C3L982|HUTH_BACAC Histidine ammonia-lyase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hutH PE=3 SV=1 31 504 1.0E-114
sp|C3P4M2|HUTH_BACAA Histidine ammonia-lyase OS=Bacillus anthracis (strain A0248) GN=hutH PE=3 SV=1 31 504 1.0E-114
sp|A7GR00|HUTH_BACCN Histidine ammonia-lyase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hutH PE=3 SV=1 58 490 2.0E-114
sp|B9IUH0|HUTH_BACCQ Histidine ammonia-lyase OS=Bacillus cereus (strain Q1) GN=hutH PE=3 SV=1 31 490 2.0E-114
sp|B7HKJ1|HUTH_BACC7 Histidine ammonia-lyase OS=Bacillus cereus (strain AH187) GN=hutH PE=3 SV=1 31 490 2.0E-114
sp|B7HCD0|HUTH_BACC4 Histidine ammonia-lyase OS=Bacillus cereus (strain B4264) GN=hutH PE=3 SV=1 58 490 2.0E-114
sp|Q81AC6|HUTH_BACCR Histidine ammonia-lyase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hutH PE=3 SV=1 58 490 2.0E-114
sp|A0RH39|HUTH_BACAH Histidine ammonia-lyase OS=Bacillus thuringiensis (strain Al Hakam) GN=hutH PE=3 SV=1 31 504 2.0E-114
sp|C1EN93|HUTH_BACC3 Histidine ammonia-lyase OS=Bacillus cereus (strain 03BB102) GN=hutH PE=3 SV=1 31 504 3.0E-114
sp|Q637H8|HUTH_BACCZ Histidine ammonia-lyase OS=Bacillus cereus (strain ZK / E33L) GN=hutH PE=3 SV=1 58 490 4.0E-114
sp|Q6HFE9|HUTH_BACHK Histidine ammonia-lyase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hutH PE=3 SV=1 58 490 5.0E-114
sp|B7ISJ2|HUTH_BACC2 Histidine ammonia-lyase OS=Bacillus cereus (strain G9842) GN=hutH PE=3 SV=1 58 490 6.0E-114
sp|A9VPT8|HUTH_BACWK Histidine ammonia-lyase OS=Bacillus weihenstephanensis (strain KBAB4) GN=hutH PE=3 SV=1 58 490 1.0E-113
sp|Q8RFC2|HUTH1_FUSNN Histidine ammonia-lyase 1 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=hutH1 PE=3 SV=1 12 510 4.0E-113
sp|Q8RDU4|HUTH2_FUSNN Histidine ammonia-lyase 2 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=hutH2 PE=3 SV=1 1 507 2.0E-110
sp|P42357|HUTH_HUMAN Histidine ammonia-lyase OS=Homo sapiens GN=HAL PE=1 SV=1 26 502 1.0E-109
sp|Q4A173|HUTH_STAS1 Histidine ammonia-lyase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hutH PE=3 SV=1 12 497 2.0E-109
sp|A7YWP4|HUTH_BOVIN Histidine ammonia-lyase OS=Bos taurus GN=HAL PE=2 SV=1 12 502 2.0E-108
sp|Q9HLI6|HUTH_THEAC Probable histidine ammonia-lyase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hutH PE=3 SV=1 58 506 5.0E-108
sp|Q978N8|HUTH_THEVO Probable histidine ammonia-lyase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hutH PE=3 SV=1 58 505 7.0E-108
sp|B5XIY2|HUTH_STRPZ Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=hutH PE=3 SV=1 38 510 1.0E-107
sp|Q891Q1|HUTH_CLOTE Histidine ammonia-lyase OS=Clostridium tetani (strain Massachusetts / E88) GN=hutH PE=3 SV=1 58 510 2.0E-107
sp|Q8NZ46|HUTH_STRP8 Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=hutH PE=3 SV=1 12 510 2.0E-107
sp|A2RGS5|HUTH_STRPG Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=hutH PE=3 SV=1 12 510 7.0E-107
sp|A8AZ70|HUTH_STRGC Histidine ammonia-lyase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=hutH PE=3 SV=1 58 510 8.0E-107
sp|P58083|HUTH_STRP1 Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M1 GN=hutH PE=3 SV=1 38 510 1.0E-106
sp|Q5X9K4|HUTH_STRP6 Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=hutH PE=3 SV=2 38 510 2.0E-106
sp|P0DB75|HUTH_STRPQ Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=hutH PE=3 SV=1 38 510 2.0E-106
sp|P0DB74|HUTH_STRP3 Histidine ammonia-lyase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=hutH PE=3 SV=1 38 510 2.0E-106
sp|Q54JI7|HUTH_DICDI Probable histidine ammonia-lyase OS=Dictyostelium discoideum GN=hal PE=2 SV=1 58 507 5.0E-106
sp|A3CL24|HUTH_STRSV Histidine ammonia-lyase OS=Streptococcus sanguinis (strain SK36) GN=hutH PE=3 SV=2 58 510 3.0E-105
sp|B9LLY0|HUTH_CHLSY Histidine ammonia-lyase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=hutH PE=3 SV=1 27 502 4.0E-105
sp|A9WHT8|HUTH_CHLAA Histidine ammonia-lyase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=hutH PE=3 SV=1 27 502 4.0E-105
sp|P35492|HUTH_MOUSE Histidine ammonia-lyase OS=Mus musculus GN=Hal PE=1 SV=1 26 497 4.0E-105
sp|P21213|HUTH_RAT Histidine ammonia-lyase OS=Rattus norvegicus GN=Hal PE=1 SV=1 26 497 7.0E-105
sp|Q82I33|HUTH_STRAW Histidine ammonia-lyase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hutH PE=3 SV=2 58 507 4.0E-103
sp|P24221|HUTH_STRGR Histidine ammonia-lyase OS=Streptomyces griseus GN=hutH PE=2 SV=2 58 507 1.0E-102
sp|Q6GKT7|HUTH_STAAR Histidine ammonia-lyase OS=Staphylococcus aureus (strain MRSA252) GN=hutH PE=3 SV=1 12 497 8.0E-102
sp|P64416|HUTH_STAAN Histidine ammonia-lyase OS=Staphylococcus aureus (strain N315) GN=hutH PE=1 SV=1 12 497 2.0E-101
sp|P64415|HUTH_STAAM Histidine ammonia-lyase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hutH PE=3 SV=1 12 497 2.0E-101
sp|A5INP9|HUTH_STAA9 Histidine ammonia-lyase OS=Staphylococcus aureus (strain JH9) GN=hutH PE=3 SV=1 12 497 2.0E-101
sp|A6TXF8|HUTH_STAA2 Histidine ammonia-lyase OS=Staphylococcus aureus (strain JH1) GN=hutH PE=3 SV=1 12 497 2.0E-101
sp|A8YYT1|HUTH_STAAT Histidine ammonia-lyase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hutH PE=3 SV=1 12 497 4.0E-101
sp|A6QD47|HUTH_STAAE Histidine ammonia-lyase OS=Staphylococcus aureus (strain Newman) GN=hutH PE=3 SV=1 12 497 4.0E-101
sp|Q5HJY8|HUTH_STAAC Histidine ammonia-lyase OS=Staphylococcus aureus (strain COL) GN=hutH PE=3 SV=1 12 497 4.0E-101
sp|Q2G2P7|HUTH_STAA8 Histidine ammonia-lyase OS=Staphylococcus aureus (strain NCTC 8325) GN=hutH PE=3 SV=1 12 497 4.0E-101
sp|Q2FKP8|HUTH_STAA3 Histidine ammonia-lyase OS=Staphylococcus aureus (strain USA300) GN=hutH PE=3 SV=1 12 497 4.0E-101
sp|Q8NYY3|HUTH_STAAW Histidine ammonia-lyase OS=Staphylococcus aureus (strain MW2) GN=hutH PE=3 SV=1 12 497 6.0E-101
sp|Q6GD82|HUTH_STAAS Histidine ammonia-lyase OS=Staphylococcus aureus (strain MSSA476) GN=hutH PE=3 SV=1 12 497 6.0E-101
sp|Q2YUR3|HUTH_STAAB Histidine ammonia-lyase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hutH PE=3 SV=1 12 499 3.0E-100
sp|B9E7E0|HUTH_MACCJ Histidine ammonia-lyase OS=Macrococcus caseolyticus (strain JCSC5402) GN=hutH PE=3 SV=1 11 490 3.0E-98
sp|Q9EWW1|HUTH_STRCO Histidine ammonia-lyase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hutH PE=3 SV=1 58 507 6.0E-98
sp|Q8GMG0|TAM_STRGL MIO-dependent tyrosine 2,3-aminomutase OS=Streptomyces globisporus PE=1 SV=1 58 506 2.0E-96
sp|Q20502|HUTH1_CAEEL Histidine ammonia-lyase OS=Caenorhabditis elegans GN=haly-1 PE=1 SV=1 24 522 2.0E-95
sp|Q9HQD5|HUTH_HALSA Probable histidine ammonia-lyase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hutH PE=3 SV=2 58 515 5.0E-92
sp|B0R544|HUTH_HALS3 Probable histidine ammonia-lyase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hutH PE=3 SV=1 58 515 5.0E-92
sp|B8ZV93|TAM_MYXFU Tyrosine 2,3-aminomutase OS=Myxococcus fulvus GN=tam PE=1 SV=1 58 491 2.0E-85
sp|B8ZV94|TAM_MYXSM Tyrosine 2,3-aminomutase OS=Myxococcus sp. (strain Mx-B0) GN=tam PE=1 SV=1 58 491 4.0E-85
sp|Q1LRV9|TALY_CUPMC Tyrosine ammonia-lyase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_0231 PE=1 SV=1 33 506 6.0E-84
sp|Q0VZ68|TAM_CHOCO Tyrosine 2,3-aminomutase OS=Chondromyces crocatus GN=cmdF PE=1 SV=1 27 478 2.0E-80
sp|Q556V9|HALL_DICDI hal-like protein DDB_G0273787/DDB_G0273081 OS=Dictyostelium discoideum GN=DDB_G0273787 PE=3 SV=1 7 484 3.0E-69
sp|Q3IWB0|TALY_RHOS4 Tyrosine ammonia-lyase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hutH PE=1 SV=1 11 492 3.0E-68
sp|P10248|PALY_RHOMI Phenylalanine ammonia-lyase OS=Rhodotorula mucilaginosa GN=PAL PE=3 SV=2 36 458 1.0E-54
sp|B2J528|PAL_NOSP7 Phenylalanine ammonia-lyase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R2068 PE=1 SV=1 24 458 4.0E-52
sp|P11544|PALY_RHOTO Phenylalanine/tyrosine ammonia-lyase OS=Rhodosporidium toruloides GN=PAL PE=1 SV=2 39 458 8.0E-51
sp|Q3M5Z3|PAL_ANAVT Phenylalanine ammonia-lyase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=Ava_3988 PE=1 SV=1 33 514 2.0E-49
sp|O04058|PALY_HELAN Phenylalanine ammonia-lyase OS=Helianthus annuus GN=PAL PE=2 SV=2 23 457 5.0E-48
sp|Q68G84|PAM_TAXWC Phenylalanine aminomutase (L-beta-phenylalanine forming) OS=Taxus wallichiana var. chinensis GN=pam PE=1 SV=1 49 457 2.0E-47
sp|Q43210|PALY_WHEAT Phenylalanine ammonia-lyase OS=Triticum aestivum GN=PAL PE=3 SV=1 8 457 2.0E-47
sp|P45725|PAL3_ARATH Phenylalanine ammonia-lyase 3 OS=Arabidopsis thaliana GN=PAL3 PE=1 SV=3 35 430 3.0E-47
sp|Q6GZ04|PAM_TAXCA Phenylalanine aminomutase (L-beta-phenylalanine forming) OS=Taxus canadensis GN=pam PE=1 SV=1 49 457 9.0E-47
sp|P31426|PAL2_SOLTU Phenylalanine ammonia-lyase 2 (Fragment) OS=Solanum tuberosum GN=PAL-2 PE=3 SV=1 23 457 1.0E-46
sp|O64963|PAL1_PRUAV Phenylalanine ammonia-lyase 1 OS=Prunus avium GN=PAL1 PE=2 SV=1 19 457 2.0E-46
sp|P45724|PAL2_ARATH Phenylalanine ammonia-lyase 2 OS=Arabidopsis thaliana GN=PAL2 PE=1 SV=2 37 457 4.0E-46
sp|P45726|PALY_CAMSI Phenylalanine ammonia-lyase OS=Camellia sinensis GN=PAL PE=2 SV=1 37 518 1.0E-45
sp|P45730|PALY_POPTR Phenylalanine ammonia-lyase OS=Populus trichocarpa GN=PAL PE=2 SV=1 37 457 2.0E-45
sp|Q9SS45|PAL4_ARATH Phenylalanine ammonia-lyase 4 OS=Arabidopsis thaliana GN=PAL4 PE=1 SV=1 37 481 2.0E-45
sp|Q9SMK9|PAL2_CICAR Phenylalanine ammonia-lyase 2 OS=Cicer arietinum GN=PAL2 PE=2 SV=1 37 457 3.0E-45
sp|P19143|PAL3_PHAVU Phenylalanine ammonia-lyase class 3 OS=Phaseolus vulgaris PE=3 SV=1 58 457 4.0E-45
sp|O23924|PALY_DIGLA Phenylalanine ammonia-lyase OS=Digitalis lanata PE=2 SV=1 19 457 5.0E-45
sp|Q96V77|PALY_USTMA Phenylalanine ammonia-lyase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAL1 PE=3 SV=2 24 502 6.0E-45
sp|Q9M568|PAL1_RUBID Phenylalanine ammonia-lyase 1 OS=Rubus idaeus GN=PAL1 PE=2 SV=1 19 457 1.0E-44
sp|Q42667|PALY_CITLI Phenylalanine ammonia-lyase OS=Citrus limon GN=PAL6 PE=2 SV=1 37 457 1.0E-44
sp|P35510|PAL1_ARATH Phenylalanine ammonia-lyase 1 OS=Arabidopsis thaliana GN=PAL1 PE=1 SV=3 23 457 2.0E-44
sp|A2X7F7|PAL2_ORYSI Phenylalanine ammonia-lyase OS=Oryza sativa subsp. indica GN=ZB8 PE=3 SV=1 28 457 3.0E-44
sp|P45732|PALY_STYHU Phenylalanine ammonia-lyase OS=Stylosanthes humilis GN=PAL17.1 PE=2 SV=1 37 457 3.0E-44
sp|P25872|PAL1_TOBAC Phenylalanine ammonia-lyase OS=Nicotiana tabacum GN=TPA1 PE=2 SV=1 23 457 4.0E-44
sp|P35511|PAL1_SOLLC Phenylalanine ammonia-lyase OS=Solanum lycopersicum GN=PAL PE=2 SV=1 23 518 4.0E-44
sp|Q0DZE0|PAL2_ORYSJ Phenylalanine ammonia-lyase OS=Oryza sativa subsp. japonica GN=ZB8 PE=2 SV=1 28 457 5.0E-44
sp|P27990|PALY_MEDSA Phenylalanine ammonia-lyase OS=Medicago sativa PE=2 SV=1 37 457 5.0E-44
sp|Q42609|PALY_BROFI Phenylalanine ammonia-lyase OS=Bromheadia finlaysoniana GN=PAL PE=2 SV=1 37 457 6.0E-44
sp|P45733|PAL3_TOBAC Phenylalanine ammonia-lyase OS=Nicotiana tabacum PE=2 SV=1 37 518 7.0E-44
sp|P45734|PALY_TRISU Phenylalanine ammonia-lyase OS=Trifolium subterraneum GN=PAL1 PE=3 SV=1 37 457 1.0E-43
sp|P19142|PAL2_PHAVU Phenylalanine ammonia-lyase class 2 OS=Phaseolus vulgaris PE=3 SV=1 37 457 2.0E-43
sp|Q42858|PAL2_IPOBA Phenylalanine ammonia-lyase OS=Ipomoea batatas PE=2 SV=1 31 457 2.0E-43
sp|P35513|PAL2_TOBAC Phenylalanine ammonia-lyase OS=Nicotiana tabacum GN=PALA PE=2 SV=2 37 457 2.0E-43
sp|P45728|PAL2_PETCR Phenylalanine ammonia-lyase 2 OS=Petroselinum crispum GN=PAL2 PE=2 SV=1 37 457 3.0E-43
sp|P31425|PAL1_SOLTU Phenylalanine ammonia-lyase 1 OS=Solanum tuberosum GN=PAL-1 PE=3 SV=1 37 518 5.0E-43
sp|P24481|PAL1_PETCR Phenylalanine ammonia-lyase 1 OS=Petroselinum crispum GN=PAL1 PE=1 SV=1 37 518 5.0E-43
sp|P14717|PAL1_ORYSJ Phenylalanine ammonia-lyase OS=Oryza sativa subsp. japonica GN=PAL PE=1 SV=2 58 457 5.0E-43
sp|O49836|PAL2_LITER Phenylalanine ammonia-lyase 2 OS=Lithospermum erythrorhizon PE=2 SV=1 37 457 6.0E-43
sp|O49835|PAL1_LITER Phenylalanine ammonia-lyase 1 OS=Lithospermum erythrorhizon PE=2 SV=1 37 519 8.0E-43
sp|P52777|PALY_PINTA Phenylalanine ammonia-lyase OS=Pinus taeda GN=PAL PE=3 SV=1 37 508 8.0E-43
sp|P27991|PAL1_SOYBN Phenylalanine ammonia-lyase 1 OS=Glycine max GN=PAL1 PE=3 SV=1 37 457 2.0E-42
sp|P26600|PAL5_SOLLC Phenylalanine ammonia-lyase OS=Solanum lycopersicum GN=PAL5 PE=3 SV=1 23 457 3.0E-42
sp|O23865|PAL1_DAUCA Phenylalanine ammonia-lyase 1 OS=Daucus carota GN=PAL1 PE=3 SV=1 3 457 3.0E-42
sp|P45729|PAL3_PETCR Phenylalanine ammonia-lyase 3 OS=Petroselinum crispum GN=PAL3 PE=2 SV=1 26 518 3.0E-42
sp|Q8VXG7|PALY_MAIZE Phenylalanine/tyrosine ammonia-lyase OS=Zea mays GN=PAL1 PE=1 SV=1 58 457 9.0E-42
sp|Q01861|PAL1_PEA Phenylalanine ammonia-lyase 1 OS=Pisum sativum GN=PAL1 PE=2 SV=1 19 457 1.0E-41
sp|P45727|PALY_PERAE Phenylalanine ammonia-lyase OS=Persea americana GN=PAL PE=2 SV=1 58 457 2.0E-41
sp|Q04593|PAL2_PEA Phenylalanine ammonia-lyase 2 OS=Pisum sativum GN=PAL2 PE=2 SV=1 19 518 6.0E-41
sp|Q40910|PAL4_POPKI Phenylalanine ammonia-lyase G4 (Fragment) OS=Populus kitakamiensis GN=PALG4 PE=3 SV=1 102 457 4.0E-40
sp|Q43052|PAL2_POPKI Phenylalanine ammonia-lyase G2B OS=Populus kitakamiensis GN=PALG2B PE=3 SV=1 37 399 1.0E-39
sp|P45731|PAL1_POPKI Phenylalanine ammonia-lyase G1 OS=Populus kitakamiensis GN=PALG1 PE=3 SV=1 101 457 5.0E-39
sp|O93967|PALY_AMAMU Phenylalanine ammonia-lyase OS=Amanita muscaria GN=PAL PE=2 SV=1 31 458 2.0E-36
sp|P14166|PAL1_IPOBA Phenylalanine ammonia-lyase OS=Ipomoea batatas GN=PAL PE=2 SV=1 37 518 5.0E-36
sp|P07218|PAL1_PHAVU Phenylalanine ammonia-lyase class 1 (Fragment) OS=Phaseolus vulgaris PE=2 SV=2 170 457 2.0E-28
sp|P45735|PALY_VITVI Phenylalanine ammonia-lyase (Fragment) OS=Vitis vinifera GN=PAL PE=2 SV=1 246 518 6.0E-23
sp|Q92195|PALY_AGABI Phenylalanine ammonia-lyase (Fragment) OS=Agaricus bisporus GN=palA PE=2 SV=1 325 458 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4181
MLPSIPLVPGEVTLQMLRAVYENECRLRLDPRVLGHVRRSADVVAAELRRGAAAAAHYGIGTGVGKLVSVRVRAA
DAATLQRNLILSHCCGVGAPLADEVVRLVLTLKLISLSRGASGVRPLLLQVLETMLEKDVLPMIPEKGSVGASGD
LAPLSHMAAALLGWGFVRFAGAVVPAGDALAEAGIRPVVLEAKEGVALINGTQTSTALALAGLFRAHRALEASLI
SGALSTDAAMASTAPFHREIHELRGHPGQAAVAAALSSLLDGSEIRASHVRGDDRVQDPYSLRCQPQVAGACLDL
LRQAGRTLRIEANGVTDNPLVLSDGAIVSGGNFHAEPVAFAADQIAMAVCELGAIAQRRIALLVDPSLSHGLPPF
LALDPGLDSGFMTAEVTAAALMSENKQLAHPASVDSTPTSAGQEDHVSMACHGARRLLPMTDNLNCVIGIEAMCA
AQGIDFRAPLLSSRPLQAVHAVIRATIPRLLGDRYLADDIAAAMELVASGRLVRAVDDGILPTLDDGCLPHL*
Coding >Hirsu2|4181
ATGCTGCCCTCCATCCCTCTAGTTCCGGGCGAGGTGACGCTGCAGATGCTCCGGGCCGTGTACGAGAACGAGTGC
AGGCTGCGGCTGGACCCCCGTGTCCTAGGACACGTGCGGCGCTCGGCGGACGTCGTGGCTGCCGAGCTCCGCCGG
GGCGCCGCCGCCGCCGCACACTATGGCATCGGGACCGGCGTCGGCAAGCTGGTCAGCGTGCGCGTCCGCGCCGCC
GACGCCGCGACGCTGCAGCGCAACCTCATCCTCTCGCACTGCTGCGGCGTCGGCGCCCCCTTGGCCGACGAGGTC
GTGCGCCTCGTTTTGACCCTGAAGCTCATCTCCCTCAGCCGCGGGGCCTCGGGCGTGCGGCCGCTGCTGCTCCAG
GTCCTGGAAACGATGCTGGAAAAGGACGTCCTGCCGATGATACCCGAGAAGGGGTCCGTCGGCGCGTCTGGCGAC
CTCGCACCGCTATCCCACATGGCCGCCGCGCTCCTGGGCTGGGGCTTCGTCCGCTTCGCCGGTGCCGTGGTGCCG
GCCGGAGACGCGCTCGCCGAGGCCGGCATCCGCCCCGTCGTGCTGGAGGCCAAGGAGGGCGTCGCGCTGATCAAC
GGGACGCAGACGTCAACGGCCCTGGCGCTCGCCGGCCTGTTCCGCGCCCACCGGGCGCTCGAGGCGTCGCTGATC
TCGGGCGCGCTATCGACCGACGCCGCCATGGCCTCGACCGCACCCTTCCACCGCGAGATCCACGAGCTGCGCGGT
CATCCCGGCCAGGCGGCCGTCGCGGCCGCCCTGAGCTCCCTGCTGGACGGGTCCGAGATCCGGGCCAGCCACGTC
CGGGGCGACGACCGGGTCCAGGACCCGTACAGCCTGCGCTGCCAGCCCCAGGTGGCCGGAGCCTGCCTCGACCTC
CTGCGCCAGGCCGGCCGGACGCTGCGGATCGAGGCCAATGGGGTGACGGACAATCCGCTCGTGCTGTCGGATGGC
GCCATCGTCTCCGGCGGCAACTTCCACGCCGAGCCAGTCGCCTTCGCCGCCGACCAGATCGCCATGGCCGTGTGC
GAACTCGGGGCCATCGCCCAGCGCCGCATCGCCCTCCTCGTCGACCCGTCGCTGAGCCACGGCCTGCCGCCATTC
CTGGCCCTCGACCCGGGCCTGGACTCGGGCTTCATGACGGCAGAGGTCACGGCCGCCGCCCTCATGTCCGAGAAC
AAGCAGCTCGCCCACCCGGCCTCGGTCGACTCGACGCCCACCTCGGCCGGCCAGGAGGACCACGTGTCCATGGCT
TGCCACGGGGCCCGACGGCTGCTACCGATGACGGACAATCTGAACTGCGTGATCGGCATCGAGGCCATGTGTGCC
GCGCAGGGCATCGATTTCCGCGCCCCTCTGCTCTCCAGTCGCCCGCTGCAGGCTGTCCACGCCGTCATCCGGGCG
ACGATCCCTCGGCTGCTCGGCGACCGCTACCTGGCTGACGATATTGCCGCTGCCATGGAGCTGGTGGCGTCCGGA
CGTCTGGTCAGGGCTGTCGACGACGGCATCCTCCCGACCTTGGACGACGGCTGCCTGCCGCACCTCTAA
Transcript >Hirsu2|4181
ATGCTGCCCTCCATCCCTCTAGTTCCGGGCGAGGTGACGCTGCAGATGCTCCGGGCCGTGTACGAGAACGAGTGC
AGGCTGCGGCTGGACCCCCGTGTCCTAGGACACGTGCGGCGCTCGGCGGACGTCGTGGCTGCCGAGCTCCGCCGG
GGCGCCGCCGCCGCCGCACACTATGGCATCGGGACCGGCGTCGGCAAGCTGGTCAGCGTGCGCGTCCGCGCCGCC
GACGCCGCGACGCTGCAGCGCAACCTCATCCTCTCGCACTGCTGCGGCGTCGGCGCCCCCTTGGCCGACGAGGTC
GTGCGCCTCGTTTTGACCCTGAAGCTCATCTCCCTCAGCCGCGGGGCCTCGGGCGTGCGGCCGCTGCTGCTCCAG
GTCCTGGAAACGATGCTGGAAAAGGACGTCCTGCCGATGATACCCGAGAAGGGGTCCGTCGGCGCGTCTGGCGAC
CTCGCACCGCTATCCCACATGGCCGCCGCGCTCCTGGGCTGGGGCTTCGTCCGCTTCGCCGGTGCCGTGGTGCCG
GCCGGAGACGCGCTCGCCGAGGCCGGCATCCGCCCCGTCGTGCTGGAGGCCAAGGAGGGCGTCGCGCTGATCAAC
GGGACGCAGACGTCAACGGCCCTGGCGCTCGCCGGCCTGTTCCGCGCCCACCGGGCGCTCGAGGCGTCGCTGATC
TCGGGCGCGCTATCGACCGACGCCGCCATGGCCTCGACCGCACCCTTCCACCGCGAGATCCACGAGCTGCGCGGT
CATCCCGGCCAGGCGGCCGTCGCGGCCGCCCTGAGCTCCCTGCTGGACGGGTCCGAGATCCGGGCCAGCCACGTC
CGGGGCGACGACCGGGTCCAGGACCCGTACAGCCTGCGCTGCCAGCCCCAGGTGGCCGGAGCCTGCCTCGACCTC
CTGCGCCAGGCCGGCCGGACGCTGCGGATCGAGGCCAATGGGGTGACGGACAATCCGCTCGTGCTGTCGGATGGC
GCCATCGTCTCCGGCGGCAACTTCCACGCCGAGCCAGTCGCCTTCGCCGCCGACCAGATCGCCATGGCCGTGTGC
GAACTCGGGGCCATCGCCCAGCGCCGCATCGCCCTCCTCGTCGACCCGTCGCTGAGCCACGGCCTGCCGCCATTC
CTGGCCCTCGACCCGGGCCTGGACTCGGGCTTCATGACGGCAGAGGTCACGGCCGCCGCCCTCATGTCCGAGAAC
AAGCAGCTCGCCCACCCGGCCTCGGTCGACTCGACGCCCACCTCGGCCGGCCAGGAGGACCACGTGTCCATGGCT
TGCCACGGGGCCCGACGGCTGCTACCGATGACGGACAATCTGAACTGCGTGATCGGCATCGAGGCCATGTGTGCC
GCGCAGGGCATCGATTTCCGCGCCCCTCTGCTCTCCAGTCGCCCGCTGCAGGCTGTCCACGCCGTCATCCGGGCG
ACGATCCCTCGGCTGCTCGGCGACCGCTACCTGGCTGACGATATTGCCGCTGCCATGGAGCTGGTGGCGTCCGGA
CGTCTGGTCAGGGCTGTCGACGACGGCATCCTCCCGACCTTGGACGACGGCTGCCTGCCGCACCTCTAA
Gene >Hirsu2|4181
ATGCTGCCCTCCATCCCTCTAGTTCCGGGCGAGGTGACGCTGCAGATGCTCCGGGCCGTGTACGAGAACGAGTGC
AGGCTGCGGCTGGACCCCCGTGTCCTAGGACACGTGCGGCGCTCGGCGGACGTCGTGGCTGCCGAGCTCCGCCGG
GGCGCCGCCGCCGCCGCACACTATGGCATCGGGACCGGCGTCGGCAAGCTGGTCAGCGTGCGCGTCCGCGCCGCC
GACGCCGCGACGCTGCAGCGCAACCTCATCCTCTCGCACTGCTGCGGCGTCGGCGCCCCCTTGGCCGACGAGGTC
GTGCGCCTCGTTTTGACCCTGAAGCTCATCTCCCTCAGCCGCGGGGCCTCGGGCGTGCGGCCGCTGCTGCTCCAG
GTCCTGGAAACGATGCTGGAAAAGGACGTCCTGCCGATGATACCCGAGAAGGGGTCCGTCGGCGCGTCTGGCGAC
CTCGCACCGCTATCCCACATGGCCGCCGCGCTCCTGGGCTGGGGCTTCGTCCGCTTCGCCGGTGCCGTGGTGCCG
GCCGGAGACGCGCTCGCCGAGGCCGGCATCCGCCCCGTCGTGCTGGAGGCCAAGGAGGGCGTCGCGCTGATCAAC
GGGACGCAGACGTCAACGGCCCTGGCGCTCGCCGGCCTGTTCCGCGCCCACCGGGCGCTCGAGGCGTCGCTGATC
TCGGGCGCGCTATCGACCGACGCCGCCATGGCCTCGACCGCACCCTTCCACCGCGAGATCCACGAGCTGCGCGGT
CATCCCGGCCAGGCGGCCGTCGCGGCCGCCCTGAGCTCCCTGCTGGACGGGTCCGAGATCCGGGCCAGCCACGTC
CGGGGCGACGACCGGGTCCAGGACCCGTACAGCCTGCGCTGCCAGCCCCAGGTGGCCGGAGCCTGCCTCGACCTC
CTGCGCCAGGCCGGCCGGACGCTGCGGATCGAGGCCAATGGGGTGACGGACAATCCGCTCGTGCTGTCGGATGGC
GCCATCGTCTCCGGCGGCAACTTCCACGCCGAGCCAGTCGCCTTCGCCGCCGACCAGATCGCCATGGCCGTGTGC
GAACTCGGGGCCATCGCCCAGCGCCGCATCGCCCTCCTCGTCGACCCGTCGCTGAGCCACGGCCTGCCGCCATTC
CTGGCCCTCGACCCGGGCCTGGACTCGGGCTTCATGACGGCAGAGGTCACGGCCGCCGCCCTCATGTCCGAGAAC
AAGCAGCTCGCCCACCCGGCCTCGGTCGACTCGACGCCCACCTCGGCCGGCCAGGAGGACCACGTGTCCATGGCT
TGCCACGGGGCCCGACGGCTGCTACCGATGACGGACAATCTGAACTGCGTGATCGGCATCGAGGCCATGTGTGCC
GCGCAGGGCATCGATTTCCGCGCCCCTCTGCTCTCCAGTCGCCCGCTGCAGGCTGTCCACGCCGTCATCCGGGCG
ACGATCCCTCGGCTGCTCGGCGACCGCTACCTGGCTGACGATATTGCCGCTGCCATGGAGCTGGTGGCGTCCGGA
CGTCTGGTCAGGGCTGTCGACGACGGCATCCTCCCGACCTTGGACGACGGCTGCCTGCCGCACCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail