Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4179
Gene name
LocationContig_215:25374..28611
Strand-
Gene length (bp)3237
Transcript length (bp)3237
Coding sequence length (bp)3237
Protein length (aa) 1079

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 1.1E-104 87 538
PF10334 ArAE_2 Aromatic acid exporter family member 2 1.2E-54 854 1069
PF13515 FUSC_2 Fusaric acid resistance protein-like 5.6E-06 714 848
PF11744 ALMT Aluminium activated malate transporter 7.4E-06 719 876

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87136|YDM5_SCHPO Uncharacterized protein C57A7.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.05 PE=4 SV=1 551 1074 1.0E-36
sp|P87136|YDM5_SCHPO Uncharacterized protein C57A7.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.05 PE=4 SV=1 42 395 6.0E-07

GO

GO Term Description Terminal node
GO:0015743 malate transport Yes
GO:0015849 organic acid transport No
GO:0008150 biological_process No
GO:0071702 organic substance transport No
GO:0006811 ion transport No
GO:0006820 anion transport No
GO:0015740 C4-dicarboxylate transport No
GO:0015711 organic anion transport No
GO:0051179 localization No
GO:0046942 carboxylic acid transport No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0006835 dicarboxylic acid transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

Domain # Start End Length
1 102 119 17
2 123 140 17
3 147 169 22
4 219 241 22
5 248 270 22
6 285 307 22
7 742 764 22
8 791 813 22
9 837 854 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4179
MSDEQGQGAAEELAAGRRDEARQQQLQAETEDRPQPWQPAQQQPQQQQQAEPDDKPPPQQPPSSPRQQPQEAKDG
DATSPGRRWSFTLPSWLDHFNLRDFKIVFRCWVAIWVGTILIFIQPALHRIGLATFFGALLLYIVPPASILAIYL
FASFLMIMGMCVAWLWGLIVMKAALSVRPSSETHAKLQDLQQMAAARAQQTGQTAEWEATILIHDGFMLDARITA
ITYAMCLVFIYALARLRCYNPKLTLFQIMGSIIIDLFLLIGPTLPSWDGSLASVLVKPGAVGVGLGLACCVLFFP
QSTSYAVLEKMEKLVRLADASLDSARKHLAGQKAGVDRLRAGKAASVGLYKTLQPILQFLPLDVSRGRWNAEDVE
GLAVPVRDVMLAHLSLVDFQVASVEAAQKEESIRRRSDTPINGGDGAAVAEKDGGTGHDIGRRQLLENAKLIEAF
TNPEMGAMRERAMQGLQGTTAELLDACSAGVKLAAQYIHTVNTCRWIGEPSQERFAELARQLEETRARIEGARAR
CVVDTTEVVLQSHGELFGPDGQIKVDDSVEPPMLHGVVTAMVIEERILDAAVSIEGLLEFMLQLGKTRTAHRIWL
PNRLRYALHWLTNGGLSVPISVSPSKTAENPDSVTGRDVANPAAQADDQADEAWRQLRVVRGKPGRAARRGRAYR
VIAGTWRWLTCPDSMYAIRITVATFATSIPAAIPHSAGFFYREKGIWAVVTVQTSLLEYMADFTLSLFARAVGTV
VGGVMGMVAWYMGSGGGPGNPYGMGASTAFWTLILVWLRLFLPPAYTMAAILCGVTFMLVIGFSYDDQHIMQYGF
PGIGYASFYKRVVLLLLGFVALVVVQMFPRPPSSTAHVRKTLANVLRSLADHYALLVSHWARPGLPGGGGEGLGS
VADQISIEVAETLLGLQGPIALLKIELGGLGPFDQRLLAATQRHCGYMNQALVRLLDLSSALPKEMRDRLVVTAG
FVDDRIIGDVMAVLAVVEQALRTGSPLPERLPVPLLSRYYEMWRAQQTQPMLSRELLHDQNYRRYCVALSSYLKF
LSTIDDLVLVLKEALGENHIVSPWDVEA*
Coding >Hirsu2|4179
ATGTCCGACGAGCAGGGCCAGGGTGCGGCCGAGGAGCTCGCGGCCGGGCGTCGAGACGAGGCTCGACAACAGCAG
CTACAGGCCGAGACCGAAGATCGGCCTCAGCCTTGGCAACCAGCACAGCAGCAGCCGCAGCAGCAGCAGCAGGCT
GAGCCCGACGACAAACCTCCGCCTCAGCAACCACCATCATCACCACGACAGCAGCCGCAGGAGGCCAAGGATGGC
GACGCAACGTCACCAGGCCGGCGCTGGTCCTTCACGCTGCCGTCCTGGCTCGACCACTTCAACCTGCGCGACTTC
AAGATCGTCTTCCGCTGCTGGGTCGCCATCTGGGTCGGCACCATCCTCATCTTCATCCAGCCGGCCCTCCACCGC
ATCGGCCTGGCCACCTTCTTCGGCGCCCTGCTGCTGTACATCGTGCCGCCGGCCAGCATCCTGGCCATCTACCTC
TTCGCCTCCTTCCTCATGATCATGGGCATGTGCGTCGCCTGGCTCTGGGGCCTGATCGTCATGAAGGCCGCCCTG
TCCGTCCGGCCCTCGTCCGAGACGCACGCCAAGCTGCAGGACCTGCAGCAGATGGCCGCCGCCCGCGCCCAGCAG
ACGGGCCAGACGGCCGAGTGGGAGGCCACCATCCTCATCCACGACGGCTTCATGCTCGACGCCCGCATCACCGCC
ATCACCTACGCCATGTGCCTCGTCTTCATCTACGCCCTGGCCCGGCTCCGCTGCTACAACCCCAAGTTGACCCTG
TTCCAGATCATGGGCAGCATCATCATCGACCTCTTCCTGCTCATCGGCCCGACCCTGCCCTCGTGGGACGGCAGC
CTGGCCTCGGTCCTGGTCAAGCCCGGCGCCGTGGGCGTCGGCCTCGGCCTCGCCTGCTGCGTCCTCTTCTTCCCC
CAGTCCACCTCGTACGCCGTCCTCGAAAAGATGGAGAAGCTCGTCCGGCTGGCCGACGCCTCGCTCGACTCCGCC
CGCAAGCACCTGGCCGGCCAGAAGGCCGGCGTCGACCGCCTGCGCGCCGGCAAGGCCGCCTCTGTCGGCCTCTAC
AAGACCCTGCAGCCGATCCTCCAGTTCCTGCCGCTCGACGTCTCGCGCGGCCGGTGGAATGCCGAGGACGTCGAG
GGCCTGGCCGTGCCCGTCCGCGACGTCATGCTCGCCCACCTGTCCCTCGTCGACTTCCAGGTCGCCAGCGTCGAG
GCGGCCCAGAAGGAGGAGAGCATCCGCCGCCGGAGCGACACCCCGATCAACGGCGGCGACGGCGCCGCCGTGGCC
GAGAAGGACGGCGGCACCGGCCACGACATCGGCCGCCGCCAGCTGCTCGAGAACGCCAAGCTGATCGAGGCCTTC
ACCAACCCCGAGATGGGCGCGATGCGCGAGCGCGCCATGCAGGGGCTCCAGGGCACCACGGCCGAGCTCCTCGAC
GCCTGCTCCGCCGGCGTCAAGCTCGCGGCCCAGTACATCCACACCGTCAACACGTGCCGCTGGATCGGCGAGCCG
TCGCAGGAGAGGTTCGCCGAGCTGGCGCGGCAGCTGGAGGAGACGCGGGCGAGGATCGAGGGGGCCCGGGCCCGC
TGCGTCGTCGACACGACCGAGGTCGTGCTGCAGAGCCACGGCGAGCTGTTCGGCCCGGACGGCCAGATCAAGGTC
GACGACAGCGTCGAGCCGCCCATGCTGCACGGCGTCGTCACCGCCATGGTCATCGAGGAGCGCATCCTGGACGCG
GCCGTCTCGATCGAGGGGCTGCTCGAGTTCATGCTGCAGCTCGGCAAGACGCGCACGGCGCACCGCATCTGGCTG
CCGAACCGCCTGCGCTACGCCCTCCACTGGCTGACCAACGGCGGGCTCTCCGTCCCCATCTCCGTCTCGCCCAGC
AAGACGGCCGAGAACCCGGACTCGGTCACGGGCCGTGACGTGGCCAACCCTGCGGCGCAGGCCGACGACCAGGCC
GACGAGGCCTGGCGCCAGCTGCGCGTGGTGCGGGGGAAGCCCGGCAGGGCCGCGCGCAGGGGCCGGGCCTACCGC
GTCATCGCCGGCACGTGGCGGTGGCTGACGTGCCCGGACAGCATGTACGCGATCCGGATCACGGTCGCGACCTTC
GCCACGTCGATCCCGGCCGCGATCCCGCACTCGGCCGGCTTCTTCTACCGCGAGAAGGGCATCTGGGCCGTCGTC
ACGGTCCAGACCAGCCTGCTCGAGTACATGGCCGACTTCACGCTGTCGCTCTTCGCCCGCGCCGTCGGCACCGTC
GTCGGCGGCGTCATGGGCATGGTGGCCTGGTACATGGGCTCGGGCGGCGGGCCCGGGAACCCGTACGGCATGGGG
GCCAGCACGGCCTTCTGGACGCTGATCCTCGTCTGGCTGCGCCTCTTCCTGCCGCCGGCCTACACCATGGCGGCC
ATCCTGTGCGGCGTCACCTTCATGCTCGTCATCGGCTTCAGCTACGACGACCAGCACATCATGCAGTACGGCTTC
CCGGGCATCGGCTACGCCTCCTTCTACAAGCGCGTCGTGTTGCTGCTGCTCGGCTTCGTCGCCCTCGTCGTCGTC
CAGATGTTCCCGCGGCCGCCGTCGAGCACGGCGCACGTGCGCAAGACGCTGGCCAACGTGCTGCGCTCGCTGGCC
GACCACTACGCCCTCCTCGTCTCGCACTGGGCCCGCCCGGGGCTGCCGGGCGGCGGCGGCGAGGGGCTCGGCAGC
GTGGCCGACCAGATCTCGATCGAGGTGGCCGAGACGCTGCTCGGGCTCCAGGGCCCCATCGCCTTGCTCAAGATC
GAGCTCGGCGGCCTGGGGCCGTTCGACCAGCGGCTGCTGGCGGCGACGCAGCGCCACTGCGGATACATGAACCAG
GCGCTCGTCCGGCTGCTGGACCTGTCGTCGGCGCTGCCCAAGGAGATGCGCGACCGGCTCGTGGTGACGGCCGGC
TTCGTCGACGACCGCATCATCGGCGACGTCATGGCCGTCCTGGCCGTCGTCGAGCAGGCCCTGCGCACCGGCTCG
CCGCTGCCGGAGCGGCTGCCCGTGCCGCTGCTGAGCCGCTACTACGAGATGTGGCGCGCGCAGCAGACGCAGCCG
ATGCTGAGCCGCGAGCTGCTGCACGACCAGAACTACCGCCGCTACTGCGTCGCCCTGTCCTCCTACCTCAAGTTC
CTCTCCACCATCGACGACCTGGTCCTCGTCCTCAAGGAAGCCCTGGGCGAGAACCACATCGTCTCTCCGTGGGAC
GTCGAGGCGTGA
Transcript >Hirsu2|4179
ATGTCCGACGAGCAGGGCCAGGGTGCGGCCGAGGAGCTCGCGGCCGGGCGTCGAGACGAGGCTCGACAACAGCAG
CTACAGGCCGAGACCGAAGATCGGCCTCAGCCTTGGCAACCAGCACAGCAGCAGCCGCAGCAGCAGCAGCAGGCT
GAGCCCGACGACAAACCTCCGCCTCAGCAACCACCATCATCACCACGACAGCAGCCGCAGGAGGCCAAGGATGGC
GACGCAACGTCACCAGGCCGGCGCTGGTCCTTCACGCTGCCGTCCTGGCTCGACCACTTCAACCTGCGCGACTTC
AAGATCGTCTTCCGCTGCTGGGTCGCCATCTGGGTCGGCACCATCCTCATCTTCATCCAGCCGGCCCTCCACCGC
ATCGGCCTGGCCACCTTCTTCGGCGCCCTGCTGCTGTACATCGTGCCGCCGGCCAGCATCCTGGCCATCTACCTC
TTCGCCTCCTTCCTCATGATCATGGGCATGTGCGTCGCCTGGCTCTGGGGCCTGATCGTCATGAAGGCCGCCCTG
TCCGTCCGGCCCTCGTCCGAGACGCACGCCAAGCTGCAGGACCTGCAGCAGATGGCCGCCGCCCGCGCCCAGCAG
ACGGGCCAGACGGCCGAGTGGGAGGCCACCATCCTCATCCACGACGGCTTCATGCTCGACGCCCGCATCACCGCC
ATCACCTACGCCATGTGCCTCGTCTTCATCTACGCCCTGGCCCGGCTCCGCTGCTACAACCCCAAGTTGACCCTG
TTCCAGATCATGGGCAGCATCATCATCGACCTCTTCCTGCTCATCGGCCCGACCCTGCCCTCGTGGGACGGCAGC
CTGGCCTCGGTCCTGGTCAAGCCCGGCGCCGTGGGCGTCGGCCTCGGCCTCGCCTGCTGCGTCCTCTTCTTCCCC
CAGTCCACCTCGTACGCCGTCCTCGAAAAGATGGAGAAGCTCGTCCGGCTGGCCGACGCCTCGCTCGACTCCGCC
CGCAAGCACCTGGCCGGCCAGAAGGCCGGCGTCGACCGCCTGCGCGCCGGCAAGGCCGCCTCTGTCGGCCTCTAC
AAGACCCTGCAGCCGATCCTCCAGTTCCTGCCGCTCGACGTCTCGCGCGGCCGGTGGAATGCCGAGGACGTCGAG
GGCCTGGCCGTGCCCGTCCGCGACGTCATGCTCGCCCACCTGTCCCTCGTCGACTTCCAGGTCGCCAGCGTCGAG
GCGGCCCAGAAGGAGGAGAGCATCCGCCGCCGGAGCGACACCCCGATCAACGGCGGCGACGGCGCCGCCGTGGCC
GAGAAGGACGGCGGCACCGGCCACGACATCGGCCGCCGCCAGCTGCTCGAGAACGCCAAGCTGATCGAGGCCTTC
ACCAACCCCGAGATGGGCGCGATGCGCGAGCGCGCCATGCAGGGGCTCCAGGGCACCACGGCCGAGCTCCTCGAC
GCCTGCTCCGCCGGCGTCAAGCTCGCGGCCCAGTACATCCACACCGTCAACACGTGCCGCTGGATCGGCGAGCCG
TCGCAGGAGAGGTTCGCCGAGCTGGCGCGGCAGCTGGAGGAGACGCGGGCGAGGATCGAGGGGGCCCGGGCCCGC
TGCGTCGTCGACACGACCGAGGTCGTGCTGCAGAGCCACGGCGAGCTGTTCGGCCCGGACGGCCAGATCAAGGTC
GACGACAGCGTCGAGCCGCCCATGCTGCACGGCGTCGTCACCGCCATGGTCATCGAGGAGCGCATCCTGGACGCG
GCCGTCTCGATCGAGGGGCTGCTCGAGTTCATGCTGCAGCTCGGCAAGACGCGCACGGCGCACCGCATCTGGCTG
CCGAACCGCCTGCGCTACGCCCTCCACTGGCTGACCAACGGCGGGCTCTCCGTCCCCATCTCCGTCTCGCCCAGC
AAGACGGCCGAGAACCCGGACTCGGTCACGGGCCGTGACGTGGCCAACCCTGCGGCGCAGGCCGACGACCAGGCC
GACGAGGCCTGGCGCCAGCTGCGCGTGGTGCGGGGGAAGCCCGGCAGGGCCGCGCGCAGGGGCCGGGCCTACCGC
GTCATCGCCGGCACGTGGCGGTGGCTGACGTGCCCGGACAGCATGTACGCGATCCGGATCACGGTCGCGACCTTC
GCCACGTCGATCCCGGCCGCGATCCCGCACTCGGCCGGCTTCTTCTACCGCGAGAAGGGCATCTGGGCCGTCGTC
ACGGTCCAGACCAGCCTGCTCGAGTACATGGCCGACTTCACGCTGTCGCTCTTCGCCCGCGCCGTCGGCACCGTC
GTCGGCGGCGTCATGGGCATGGTGGCCTGGTACATGGGCTCGGGCGGCGGGCCCGGGAACCCGTACGGCATGGGG
GCCAGCACGGCCTTCTGGACGCTGATCCTCGTCTGGCTGCGCCTCTTCCTGCCGCCGGCCTACACCATGGCGGCC
ATCCTGTGCGGCGTCACCTTCATGCTCGTCATCGGCTTCAGCTACGACGACCAGCACATCATGCAGTACGGCTTC
CCGGGCATCGGCTACGCCTCCTTCTACAAGCGCGTCGTGTTGCTGCTGCTCGGCTTCGTCGCCCTCGTCGTCGTC
CAGATGTTCCCGCGGCCGCCGTCGAGCACGGCGCACGTGCGCAAGACGCTGGCCAACGTGCTGCGCTCGCTGGCC
GACCACTACGCCCTCCTCGTCTCGCACTGGGCCCGCCCGGGGCTGCCGGGCGGCGGCGGCGAGGGGCTCGGCAGC
GTGGCCGACCAGATCTCGATCGAGGTGGCCGAGACGCTGCTCGGGCTCCAGGGCCCCATCGCCTTGCTCAAGATC
GAGCTCGGCGGCCTGGGGCCGTTCGACCAGCGGCTGCTGGCGGCGACGCAGCGCCACTGCGGATACATGAACCAG
GCGCTCGTCCGGCTGCTGGACCTGTCGTCGGCGCTGCCCAAGGAGATGCGCGACCGGCTCGTGGTGACGGCCGGC
TTCGTCGACGACCGCATCATCGGCGACGTCATGGCCGTCCTGGCCGTCGTCGAGCAGGCCCTGCGCACCGGCTCG
CCGCTGCCGGAGCGGCTGCCCGTGCCGCTGCTGAGCCGCTACTACGAGATGTGGCGCGCGCAGCAGACGCAGCCG
ATGCTGAGCCGCGAGCTGCTGCACGACCAGAACTACCGCCGCTACTGCGTCGCCCTGTCCTCCTACCTCAAGTTC
CTCTCCACCATCGACGACCTGGTCCTCGTCCTCAAGGAAGCCCTGGGCGAGAACCACATCGTCTCTCCGTGGGAC
GTCGAGGCGTGA
Gene >Hirsu2|4179
ATGTCCGACGAGCAGGGCCAGGGTGCGGCCGAGGAGCTCGCGGCCGGGCGTCGAGACGAGGCTCGACAACAGCAG
CTACAGGCCGAGACCGAAGATCGGCCTCAGCCTTGGCAACCAGCACAGCAGCAGCCGCAGCAGCAGCAGCAGGCT
GAGCCCGACGACAAACCTCCGCCTCAGCAACCACCATCATCACCACGACAGCAGCCGCAGGAGGCCAAGGATGGC
GACGCAACGTCACCAGGCCGGCGCTGGTCCTTCACGCTGCCGTCCTGGCTCGACCACTTCAACCTGCGCGACTTC
AAGATCGTCTTCCGCTGCTGGGTCGCCATCTGGGTCGGCACCATCCTCATCTTCATCCAGCCGGCCCTCCACCGC
ATCGGCCTGGCCACCTTCTTCGGCGCCCTGCTGCTGTACATCGTGCCGCCGGCCAGCATCCTGGCCATCTACCTC
TTCGCCTCCTTCCTCATGATCATGGGCATGTGCGTCGCCTGGCTCTGGGGCCTGATCGTCATGAAGGCCGCCCTG
TCCGTCCGGCCCTCGTCCGAGACGCACGCCAAGCTGCAGGACCTGCAGCAGATGGCCGCCGCCCGCGCCCAGCAG
ACGGGCCAGACGGCCGAGTGGGAGGCCACCATCCTCATCCACGACGGCTTCATGCTCGACGCCCGCATCACCGCC
ATCACCTACGCCATGTGCCTCGTCTTCATCTACGCCCTGGCCCGGCTCCGCTGCTACAACCCCAAGTTGACCCTG
TTCCAGATCATGGGCAGCATCATCATCGACCTCTTCCTGCTCATCGGCCCGACCCTGCCCTCGTGGGACGGCAGC
CTGGCCTCGGTCCTGGTCAAGCCCGGCGCCGTGGGCGTCGGCCTCGGCCTCGCCTGCTGCGTCCTCTTCTTCCCC
CAGTCCACCTCGTACGCCGTCCTCGAAAAGATGGAGAAGCTCGTCCGGCTGGCCGACGCCTCGCTCGACTCCGCC
CGCAAGCACCTGGCCGGCCAGAAGGCCGGCGTCGACCGCCTGCGCGCCGGCAAGGCCGCCTCTGTCGGCCTCTAC
AAGACCCTGCAGCCGATCCTCCAGTTCCTGCCGCTCGACGTCTCGCGCGGCCGGTGGAATGCCGAGGACGTCGAG
GGCCTGGCCGTGCCCGTCCGCGACGTCATGCTCGCCCACCTGTCCCTCGTCGACTTCCAGGTCGCCAGCGTCGAG
GCGGCCCAGAAGGAGGAGAGCATCCGCCGCCGGAGCGACACCCCGATCAACGGCGGCGACGGCGCCGCCGTGGCC
GAGAAGGACGGCGGCACCGGCCACGACATCGGCCGCCGCCAGCTGCTCGAGAACGCCAAGCTGATCGAGGCCTTC
ACCAACCCCGAGATGGGCGCGATGCGCGAGCGCGCCATGCAGGGGCTCCAGGGCACCACGGCCGAGCTCCTCGAC
GCCTGCTCCGCCGGCGTCAAGCTCGCGGCCCAGTACATCCACACCGTCAACACGTGCCGCTGGATCGGCGAGCCG
TCGCAGGAGAGGTTCGCCGAGCTGGCGCGGCAGCTGGAGGAGACGCGGGCGAGGATCGAGGGGGCCCGGGCCCGC
TGCGTCGTCGACACGACCGAGGTCGTGCTGCAGAGCCACGGCGAGCTGTTCGGCCCGGACGGCCAGATCAAGGTC
GACGACAGCGTCGAGCCGCCCATGCTGCACGGCGTCGTCACCGCCATGGTCATCGAGGAGCGCATCCTGGACGCG
GCCGTCTCGATCGAGGGGCTGCTCGAGTTCATGCTGCAGCTCGGCAAGACGCGCACGGCGCACCGCATCTGGCTG
CCGAACCGCCTGCGCTACGCCCTCCACTGGCTGACCAACGGCGGGCTCTCCGTCCCCATCTCCGTCTCGCCCAGC
AAGACGGCCGAGAACCCGGACTCGGTCACGGGCCGTGACGTGGCCAACCCTGCGGCGCAGGCCGACGACCAGGCC
GACGAGGCCTGGCGCCAGCTGCGCGTGGTGCGGGGGAAGCCCGGCAGGGCCGCGCGCAGGGGCCGGGCCTACCGC
GTCATCGCCGGCACGTGGCGGTGGCTGACGTGCCCGGACAGCATGTACGCGATCCGGATCACGGTCGCGACCTTC
GCCACGTCGATCCCGGCCGCGATCCCGCACTCGGCCGGCTTCTTCTACCGCGAGAAGGGCATCTGGGCCGTCGTC
ACGGTCCAGACCAGCCTGCTCGAGTACATGGCCGACTTCACGCTGTCGCTCTTCGCCCGCGCCGTCGGCACCGTC
GTCGGCGGCGTCATGGGCATGGTGGCCTGGTACATGGGCTCGGGCGGCGGGCCCGGGAACCCGTACGGCATGGGG
GCCAGCACGGCCTTCTGGACGCTGATCCTCGTCTGGCTGCGCCTCTTCCTGCCGCCGGCCTACACCATGGCGGCC
ATCCTGTGCGGCGTCACCTTCATGCTCGTCATCGGCTTCAGCTACGACGACCAGCACATCATGCAGTACGGCTTC
CCGGGCATCGGCTACGCCTCCTTCTACAAGCGCGTCGTGTTGCTGCTGCTCGGCTTCGTCGCCCTCGTCGTCGTC
CAGATGTTCCCGCGGCCGCCGTCGAGCACGGCGCACGTGCGCAAGACGCTGGCCAACGTGCTGCGCTCGCTGGCC
GACCACTACGCCCTCCTCGTCTCGCACTGGGCCCGCCCGGGGCTGCCGGGCGGCGGCGGCGAGGGGCTCGGCAGC
GTGGCCGACCAGATCTCGATCGAGGTGGCCGAGACGCTGCTCGGGCTCCAGGGCCCCATCGCCTTGCTCAAGATC
GAGCTCGGCGGCCTGGGGCCGTTCGACCAGCGGCTGCTGGCGGCGACGCAGCGCCACTGCGGATACATGAACCAG
GCGCTCGTCCGGCTGCTGGACCTGTCGTCGGCGCTGCCCAAGGAGATGCGCGACCGGCTCGTGGTGACGGCCGGC
TTCGTCGACGACCGCATCATCGGCGACGTCATGGCCGTCCTGGCCGTCGTCGAGCAGGCCCTGCGCACCGGCTCG
CCGCTGCCGGAGCGGCTGCCCGTGCCGCTGCTGAGCCGCTACTACGAGATGTGGCGCGCGCAGCAGACGCAGCCG
ATGCTGAGCCGCGAGCTGCTGCACGACCAGAACTACCGCCGCTACTGCGTCGCCCTGTCCTCCTACCTCAAGTTC
CTCTCCACCATCGACGACCTGGTCCTCGTCCTCAAGGAAGCCCTGGGCGAGAACCACATCGTCTCTCCGTGGGAC
GTCGAGGCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail