Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|417
Gene name
LocationContig_1083:561..2318
Strand-
Gene length (bp)1757
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02127 Peptidase_M18 Aminopeptidase I zinc metalloprotease (M18) 1.3E-122 95 542

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14904|AMPL_YEAST Vacuolar aminopeptidase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APE1 PE=1 SV=2 86 553 6.0E-118
sp|Q2UPZ7|DNPEP_ASPOR Aspartyl aminopeptidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dapA PE=1 SV=1 92 546 1.0E-101
sp|P38821|DNPEP_YEAST Aspartyl aminopeptidase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APE4 PE=1 SV=1 75 552 2.0E-101
sp|O36014|DNPEP_SCHPO Aspartyl aminopeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aap1 PE=1 SV=1 92 552 5.0E-97
sp|B9RAJ0|DNPEP_RICCO Probable aspartyl aminopeptidase OS=Ricinus communis GN=RCOM_1506700 PE=2 SV=2 92 552 1.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14904|AMPL_YEAST Vacuolar aminopeptidase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APE1 PE=1 SV=2 86 553 6.0E-118
sp|Q2UPZ7|DNPEP_ASPOR Aspartyl aminopeptidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dapA PE=1 SV=1 92 546 1.0E-101
sp|P38821|DNPEP_YEAST Aspartyl aminopeptidase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APE4 PE=1 SV=1 75 552 2.0E-101
sp|O36014|DNPEP_SCHPO Aspartyl aminopeptidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aap1 PE=1 SV=1 92 552 5.0E-97
sp|B9RAJ0|DNPEP_RICCO Probable aspartyl aminopeptidase OS=Ricinus communis GN=RCOM_1506700 PE=2 SV=2 92 552 1.0E-93
sp|Q2HJH1|DNPEP_BOVIN Aspartyl aminopeptidase OS=Bos taurus GN=DNPEP PE=1 SV=1 86 544 2.0E-88
sp|Q9Z2W0|DNPEP_MOUSE Aspartyl aminopeptidase OS=Mus musculus GN=Dnpep PE=1 SV=2 86 544 5.0E-87
sp|Q5RBT2|DNPEP_PONAB Aspartyl aminopeptidase OS=Pongo abelii GN=DNPEP PE=2 SV=1 90 544 1.0E-85
sp|Q9ULA0|DNPEP_HUMAN Aspartyl aminopeptidase OS=Homo sapiens GN=DNPEP PE=1 SV=1 90 544 9.0E-85
sp|Q54M70|DNPEP_DICDI Aspartyl aminopeptidase OS=Dictyostelium discoideum GN=dnpep PE=1 SV=1 90 550 1.0E-79
sp|Q19087|DNPEP_CAEEL Aspartyl aminopeptidase OS=Caenorhabditis elegans GN=dnpp-1 PE=1 SV=1 81 524 5.0E-74
sp|Q97LF4|APEB_CLOAB Probable M18 family aminopeptidase 2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=apeB PE=3 SV=1 88 544 6.0E-68
sp|A0PYH7|APEB_CLONN Probable M18 family aminopeptidase 2 OS=Clostridium novyi (strain NT) GN=apeB PE=3 SV=1 88 544 7.0E-68
sp|B1J1S3|APEB_PSEPW Probable M18 family aminopeptidase 2 OS=Pseudomonas putida (strain W619) GN=apeB PE=3 SV=1 86 542 1.0E-67
sp|Q48L80|APEB_PSE14 Probable M18 family aminopeptidase 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=apeB PE=3 SV=1 92 542 1.0E-67
sp|A4XRN0|APEB_PSEMY Probable M18 family aminopeptidase 2 OS=Pseudomonas mendocina (strain ymp) GN=apeB PE=3 SV=1 86 542 3.0E-67
sp|B0KTU0|APEB_PSEPG Probable M18 family aminopeptidase 2 OS=Pseudomonas putida (strain GB-1) GN=apeB PE=3 SV=1 86 542 7.0E-67
sp|Q4ZW15|APEB_PSEU2 Probable M18 family aminopeptidase 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=apeB PE=3 SV=1 88 542 1.0E-66
sp|Q87YC5|APEB_PSESM Probable M18 family aminopeptidase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=apeB PE=3 SV=1 86 542 9.0E-66
sp|C3K0D7|APEB_PSEFS Probable M18 family aminopeptidase 2 OS=Pseudomonas fluorescens (strain SBW25) GN=apeB PE=3 SV=1 86 542 1.0E-65
sp|Q1IDE6|APEB_PSEE4 Probable M18 family aminopeptidase 2 OS=Pseudomonas entomophila (strain L48) GN=apeB PE=3 SV=1 86 542 1.0E-65
sp|A5W7K3|APEB_PSEP1 Probable M18 family aminopeptidase 2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=apeB PE=3 SV=1 86 542 4.0E-64
sp|Q88M44|APEB_PSEPK Probable M18 family aminopeptidase 2 OS=Pseudomonas putida (strain KT2440) GN=apeB PE=3 SV=1 86 542 5.0E-64
sp|Q3KFM3|APEB_PSEPF Probable M18 family aminopeptidase 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=apeB PE=3 SV=1 86 542 4.0E-62
sp|Q02Q78|APEB_PSEAB Probable M18 family aminopeptidase 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=apeB PE=3 SV=1 88 542 6.0E-61
sp|A6V2H4|APEB_PSEA7 Probable M18 family aminopeptidase 2 OS=Pseudomonas aeruginosa (strain PA7) GN=apeB PE=3 SV=1 88 542 7.0E-61
sp|Q9HYZ3|APEB_PSEAE Probable M18 family aminopeptidase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=apeB PE=1 SV=1 88 542 7.0E-61
sp|B7V7X2|APEB_PSEA8 Probable M18 family aminopeptidase 2 OS=Pseudomonas aeruginosa (strain LESB58) GN=apeB PE=3 SV=1 88 542 7.0E-61
sp|C1DQM8|APEB_AZOVD Probable M18 family aminopeptidase 2 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=apeB PE=3 SV=1 88 542 6.0E-59
sp|A4VJG1|APEB_PSEU5 Probable M18 family aminopeptidase 2 OS=Pseudomonas stutzeri (strain A1501) GN=apeB PE=3 SV=1 86 547 9.0E-59
sp|Q50022|APEB_MYCLE Probable M18 family aminopeptidase 2 OS=Mycobacterium leprae (strain TN) GN=apeB PE=3 SV=2 92 543 2.0E-48
sp|Q9XA76|APEB_STRCO Probable M18 family aminopeptidase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=apeB PE=3 SV=1 89 543 1.0E-45
sp|Q82F74|APEB_STRAW Probable M18 family aminopeptidase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=apeB PE=3 SV=1 89 544 3.0E-42
sp|P9WHT0|APEB_MYCTO Probable M18 family aminopeptidase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=apeB PE=3 SV=1 92 543 2.0E-41
sp|C1ALD5|APEB_MYCBT Probable M18 family aminopeptidase 2 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=apeB PE=3 SV=1 92 543 2.0E-41
sp|A1KGT3|APEB_MYCBP Probable M18 family aminopeptidase 2 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=apeB PE=3 SV=1 92 543 2.0E-41
sp|P59951|APEB_MYCBO Probable M18 family aminopeptidase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=apeB PE=3 SV=1 92 543 2.0E-41
sp|P9WHT1|APEB_MYCTU Probable M18 family aminopeptidase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=apeB PE=1 SV=1 92 543 1.0E-40
sp|A5U0I9|APEB_MYCTA Probable M18 family aminopeptidase 2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=apeB PE=3 SV=1 92 543 1.0E-40
sp|O51572|APEB_BORBU Probable M18 family aminopeptidase 2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=apeB PE=3 SV=1 90 544 1.0E-39
sp|Q661Q3|APEA_BORBP Probable M18 family aminopeptidase 1 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=apeA PE=3 SV=1 88 542 1.0E-16
sp|O86957|APEA_THENE Probable M18 family aminopeptidase 1 OS=Thermotoga neapolitana GN=apeA PE=3 SV=1 86 544 5.0E-15
sp|Q9WYJ9|APEA_THEMA Probable M18 family aminopeptidase 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=apeA PE=1 SV=2 86 522 1.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008270 zinc ion binding Yes
GO:0004177 aminopeptidase activity Yes
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0046914 transition metal ion binding No
GO:0008233 peptidase activity No
GO:0019538 protein metabolic process No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008238 exopeptidase activity No
GO:0043167 ion binding No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|417
MTKRSPGMASPHASALPLRHPAPAPAPSTPARSKTFVLADMDGRASQDNDACASCIAQLSPAEVGQVNWRMADDC
RLCQVAACKPEAFTKPFCDFLRENPTVFHTVDYFKRKLAHRGFQELPARDAWAGKVHPGGKYWTTRNGSSLVAFT
VGKSYEPGNGVGMVAGHIDALTARLKPVSTRPSKAGYVQLGVAPYAGGLNATWWDRDLSIGGRVIVRDEETGKTG
IRLVKVDWPIAKIPTLAPHFGVGMFGDNNKETQAVPIIGLESAADDAAAAEPLGPPGCFARTQPPRLVKLIARQL
GLESSPGAIVNWELELYDSQPAQTCGIDREFITAGRIDDKLCSWAALMGLLAADDDDADGYVKLVALFDDEEIGS
LLRQGARSNLLPLVVERAVEALCASSSSSSAAAFGPGLVGQTYARSFLVSADVTHAGHPNFLENYLDGHVPRLNV
GVTVTGDSNGHMTTDAVSAAVLRRAAALSGARTQDFQIRNDSVSGGTIGPSLSSLMGVRAADAGLPQLSMHSVRA
TTGALDPGLGIRFFKGFLDHWERIDAEWEP*
Coding >Hirsu2|417
ATGACGAAGCGATCGCCCGGCATGGCCAGCCCGCACGCCTCGGCGCTGCCCTTGCGCCACCCGGCCCCGGCCCCG
GCCCCGTCCACACCGGCGCGATCCAAGACCTTCGTCCTCGCCGACATGGACGGCCGCGCGTCGCAGGACAACGAC
GCCTGCGCCAGCTGCATCGCCCAGCTCTCCCCCGCCGAGGTCGGCCAGGTCAACTGGCGCATGGCCGATGACTGT
CGGCTGTGCCAGGTGGCCGCCTGCAAGCCCGAGGCCTTCACCAAGCCCTTCTGCGACTTCTTGCGCGAGAACCCG
ACCGTCTTCCACACCGTCGACTACTTCAAGCGGAAGCTGGCCCATCGGGGCTTCCAGGAGCTCCCCGCGCGAGAC
GCCTGGGCCGGCAAGGTCCATCCCGGCGGCAAGTACTGGACGACGCGCAACGGGAGCTCGCTCGTCGCCTTCACC
GTCGGCAAGTCGTACGAGCCCGGCAACGGCGTCGGCATGGTGGCCGGCCACATCGACGCCCTGACGGCCCGGCTC
AAGCCCGTCAGCACGCGGCCGTCCAAGGCCGGCTACGTCCAGCTGGGCGTCGCGCCCTACGCCGGCGGCCTGAAC
GCGACCTGGTGGGACCGCGACCTGAGCATCGGCGGCCGCGTCATCGTGCGCGACGAGGAGACGGGCAAGACGGGC
ATCCGGCTCGTCAAGGTCGACTGGCCCATCGCCAAGATCCCGACGCTGGCGCCCCACTTCGGCGTCGGCATGTTC
GGCGACAACAACAAGGAGACGCAGGCGGTGCCCATCATCGGGCTCGAGAGCGCCGCCGACGACGCCGCCGCCGCC
GAGCCGCTCGGCCCGCCCGGCTGCTTCGCCCGCACGCAGCCGCCGCGGCTGGTCAAGCTGATCGCGCGGCAGCTG
GGCCTCGAGTCGTCGCCCGGCGCCATCGTCAACTGGGAGCTGGAGCTGTACGACAGCCAGCCGGCGCAGACGTGC
GGCATCGACCGCGAGTTCATCACGGCCGGCCGCATCGACGACAAGCTCTGCTCCTGGGCCGCCCTCATGGGCCTG
CTGGCCGCCGACGACGACGACGCCGACGGCTACGTCAAGCTCGTCGCCCTCTTCGACGACGAGGAGATCGGCTCG
CTGCTCCGCCAGGGCGCCCGCAGCAACCTGCTGCCGCTCGTCGTCGAGCGCGCCGTCGAGGCCCTGTGCGCGTCA
TCGTCGTCGTCGAGCGCCGCCGCCTTCGGCCCGGGCCTCGTCGGCCAGACCTACGCCCGCTCCTTCCTCGTCTCG
GCCGACGTCACCCACGCCGGCCACCCCAACTTCCTGGAGAACTACCTCGACGGCCACGTGCCGCGGCTCAACGTG
GGCGTGACGGTGACGGGCGACAGCAACGGCCACATGACGACCGACGCCGTGTCGGCGGCGGTGCTGCGCCGCGCC
GCCGCCCTGAGCGGCGCCCGCACCCAGGACTTCCAGATCCGCAACGACTCCGTCAGCGGCGGCACCATCGGGCCC
TCGCTCTCCAGCCTCATGGGCGTCCGCGCCGCCGACGCCGGCCTGCCCCAGCTGAGCATGCACTCGGTCCGCGCC
ACCACCGGCGCCCTCGACCCGGGCCTCGGCATCCGCTTCTTCAAGGGCTTCCTCGACCACTGGGAGCGCATCGAC
GCCGAGTGGGAGCCCTGA
Transcript >Hirsu2|417
ATGACGAAGCGATCGCCCGGCATGGCCAGCCCGCACGCCTCGGCGCTGCCCTTGCGCCACCCGGCCCCGGCCCCG
GCCCCGTCCACACCGGCGCGATCCAAGACCTTCGTCCTCGCCGACATGGACGGCCGCGCGTCGCAGGACAACGAC
GCCTGCGCCAGCTGCATCGCCCAGCTCTCCCCCGCCGAGGTCGGCCAGGTCAACTGGCGCATGGCCGATGACTGT
CGGCTGTGCCAGGTGGCCGCCTGCAAGCCCGAGGCCTTCACCAAGCCCTTCTGCGACTTCTTGCGCGAGAACCCG
ACCGTCTTCCACACCGTCGACTACTTCAAGCGGAAGCTGGCCCATCGGGGCTTCCAGGAGCTCCCCGCGCGAGAC
GCCTGGGCCGGCAAGGTCCATCCCGGCGGCAAGTACTGGACGACGCGCAACGGGAGCTCGCTCGTCGCCTTCACC
GTCGGCAAGTCGTACGAGCCCGGCAACGGCGTCGGCATGGTGGCCGGCCACATCGACGCCCTGACGGCCCGGCTC
AAGCCCGTCAGCACGCGGCCGTCCAAGGCCGGCTACGTCCAGCTGGGCGTCGCGCCCTACGCCGGCGGCCTGAAC
GCGACCTGGTGGGACCGCGACCTGAGCATCGGCGGCCGCGTCATCGTGCGCGACGAGGAGACGGGCAAGACGGGC
ATCCGGCTCGTCAAGGTCGACTGGCCCATCGCCAAGATCCCGACGCTGGCGCCCCACTTCGGCGTCGGCATGTTC
GGCGACAACAACAAGGAGACGCAGGCGGTGCCCATCATCGGGCTCGAGAGCGCCGCCGACGACGCCGCCGCCGCC
GAGCCGCTCGGCCCGCCCGGCTGCTTCGCCCGCACGCAGCCGCCGCGGCTGGTCAAGCTGATCGCGCGGCAGCTG
GGCCTCGAGTCGTCGCCCGGCGCCATCGTCAACTGGGAGCTGGAGCTGTACGACAGCCAGCCGGCGCAGACGTGC
GGCATCGACCGCGAGTTCATCACGGCCGGCCGCATCGACGACAAGCTCTGCTCCTGGGCCGCCCTCATGGGCCTG
CTGGCCGCCGACGACGACGACGCCGACGGCTACGTCAAGCTCGTCGCCCTCTTCGACGACGAGGAGATCGGCTCG
CTGCTCCGCCAGGGCGCCCGCAGCAACCTGCTGCCGCTCGTCGTCGAGCGCGCCGTCGAGGCCCTGTGCGCGTCA
TCGTCGTCGTCGAGCGCCGCCGCCTTCGGCCCGGGCCTCGTCGGCCAGACCTACGCCCGCTCCTTCCTCGTCTCG
GCCGACGTCACCCACGCCGGCCACCCCAACTTCCTGGAGAACTACCTCGACGGCCACGTGCCGCGGCTCAACGTG
GGCGTGACGGTGACGGGCGACAGCAACGGCCACATGACGACCGACGCCGTGTCGGCGGCGGTGCTGCGCCGCGCC
GCCGCCCTGAGCGGCGCCCGCACCCAGGACTTCCAGATCCGCAACGACTCCGTCAGCGGCGGCACCATCGGGCCC
TCGCTCTCCAGCCTCATGGGCGTCCGCGCCGCCGACGCCGGCCTGCCCCAGCTGAGCATGCACTCGGTCCGCGCC
ACCACCGGCGCCCTCGACCCGGGCCTCGGCATCCGCTTCTTCAAGGGCTTCCTCGACCACTGGGAGCGCATCGAC
GCCGAGTGGGAGCCCTGA
Gene >Hirsu2|417
ATGACGAAGCGATCGCCCGGCATGGCCAGCCCGCACGCCTCGGCGCTGCCCTTGCGCCACCCGGCCCCGGCCCCG
GCCCCGTCCACACCGGCGCGATCCAAGACCTTCGTCCTCGCCGACATGGACGGCCGCGCGTCGCAGGACAACGAC
GCCTGCGCCAGCTGCATCGCCCAGCTCTCCCCCGCCGAGGTCGGCCAGGTCAACTGGCGCATGGCCGATGACTGT
CGGCTGTGCCAGGTGGCCGCCTGCAAGCCCGAGGCCTTCACCAAGCCCTTCTGCGACTTCTTGCGCGAGAACCCG
ACCGTCTTCCACACCGTCGACTACTTCAAGCGGAAGCTGGCCCATCGGGGCTTCCAGGAGGTACGTTGTGCTTGC
CGGTCTTGCGGCACCCACGCCCGTTCGCATCTTTTGGCTTGACAAGGGCGAGGCTGACGATGATGCCCCTACAGC
TCCCCGCGCGAGACGCCTGGGCCGGCAAGGTCCATCCCGGCGGCAAGTACTGGACGACGCGCAACGGGAGCTCGC
TCGTCGCCTTCACCGTCGGCAAGTCGTACGAGCCCGGCAACGGCGTCGGCATGGTGGCCGGCCACATCGACGCCC
TGACGGCCCGGCTCAAGCCCGTCAGCACGCGGCCGTCCAAGGCCGGCTACGTCCAGCTGGGCGTCGCGCCCTACG
CCGGCGGCCTGAACGCGACCTGGTGGGACCGCGACCTGAGCATCGGCGGCCGCGTCATCGTGCGCGACGAGGAGA
CGGGCAAGACGGGCATCCGGCTCGTCAAGGTCGACTGGCCCATCGCCAAGATCCCGACGCTGGCGCCCCACTTCG
GCGTCGGCATGTTCGGCGACAACAACAAGGAGACGCAGGCGGTGCCCATCATCGGGCTCGAGAGCGCCGCCGACG
ACGCCGCCGCCGCCGAGCCGCTCGGCCCGCCCGGCTGCTTCGCCCGCACGCAGCCGCCGCGGCTGGTCAAGCTGA
TCGCGCGGCAGCTGGGCCTCGAGTCGTCGCCCGGCGCCATCGTCAACTGGGAGCTGGAGCTGTACGACAGCCAGC
CGGCGCAGACGTGCGGCATCGACCGCGAGTTCATCACGGCCGGCCGCATCGACGACAAGCTCTGCTCCTGGGCCG
CCCTCATGGGCCTGCTGGCCGCCGACGACGACGACGCCGACGGCTACGTCAAGCTCGTCGCCCTCTTCGACGACG
AGGAGATCGGCTCGCTGCTCCGCCAGGGCGCCCGCAGCAACCTGCTGCCGCTCGTCGTCGAGCGCGCCGTCGAGG
CCCTGTGCGCGTCATCGTCGTCGTCGAGCGCCGCCGCCTTCGGCCCGGGCCTCGTCGGCCAGACCTACGCCCGCT
CCTTCCTCGTCTCGGCCGACGTCACCCACGCCGGCCACCCCAACTTCCTGGAGAACTACCTCGACGGCCACGTGC
CGCGGCTCAACGTGGGCGTGACGGTGACGGGCGACAGCAACGGCCACATGACGACCGACGCCGTGTCGGCGGCGG
TGCTGCGCCGCGCCGCCGCCCTGAGCGGCGCCCGCACCCAGGACTTCCAGATCCGCAACGACTCCGTCAGCGGCG
GCACCATCGGGCCCTCGCTCTCCAGCCTCATGGGCGTCCGCGCCGCCGACGCCGGCCTGCCCCAGCTGAGCATGC
ACTCGGTCCGCGCCACCACCGGCGCCCTCGACCCGGGCCTCGGCATCCGCTTCTTCAAGGGCTTCCTCGACCACT
GGGAGCGCATCGACGCCGAGTGGGAGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail