Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4167
Gene name
LocationContig_2148:787..1630
Strand+
Gene length (bp)843
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 4.6E-15 39 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74746|SPF31_SCHPO J domain-containing protein spf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spf31 PE=3 SV=1 23 196 5.0E-39
sp|O75937|DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens GN=DNAJC8 PE=1 SV=2 36 202 4.0E-14
sp|Q642C0|DNJC8_RAT DnaJ homolog subfamily C member 8 OS=Rattus norvegicus GN=Dnajc8 PE=2 SV=1 36 202 8.0E-14
sp|Q6NZB0|DNJC8_MOUSE DnaJ homolog subfamily C member 8 OS=Mus musculus GN=Dnajc8 PE=1 SV=2 36 202 8.0E-14
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 39 101 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74746|SPF31_SCHPO J domain-containing protein spf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spf31 PE=3 SV=1 23 196 5.0E-39
sp|O75937|DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens GN=DNAJC8 PE=1 SV=2 36 202 4.0E-14
sp|Q642C0|DNJC8_RAT DnaJ homolog subfamily C member 8 OS=Rattus norvegicus GN=Dnajc8 PE=2 SV=1 36 202 8.0E-14
sp|Q6NZB0|DNJC8_MOUSE DnaJ homolog subfamily C member 8 OS=Mus musculus GN=Dnajc8 PE=1 SV=2 36 202 8.0E-14
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 39 101 1.0E-09
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 39 101 1.0E-09
sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 39 101 2.0E-09
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 39 101 2.0E-08
sp|Q9FH28|DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana GN=ATJ49 PE=2 SV=2 39 102 2.0E-07
sp|Q9NVM6|DJC17_HUMAN DnaJ homolog subfamily C member 17 OS=Homo sapiens GN=DNAJC17 PE=1 SV=1 36 100 5.0E-07
sp|Q0WT48|DNJ21_ARATH DnaJ protein ERDJ2A OS=Arabidopsis thaliana GN=ERDJ2A PE=1 SV=1 38 96 5.0E-07
sp|Q91WT4|DJC17_MOUSE DnaJ homolog subfamily C member 17 OS=Mus musculus GN=Dnajc17 PE=1 SV=2 36 100 5.0E-07
sp|O13633|YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi041 PE=1 SV=1 29 105 8.0E-07
sp|D2H417|DNJ5B_AILME DnaJ homolog subfamily C member 5B OS=Ailuropoda melanoleuca GN=DNAJC5B PE=3 SV=1 41 141 1.0E-06
sp|Q5RCM7|DJC16_PONAB DnaJ homolog subfamily C member 16 OS=Pongo abelii GN=DNAJC16 PE=2 SV=1 29 101 1.0E-06
sp|Q5UP23|YR260_MIMIV DnaJ-like protein R260 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R260 PE=3 SV=1 39 101 2.0E-06
sp|Q9Y2G8|DJC16_HUMAN DnaJ homolog subfamily C member 16 OS=Homo sapiens GN=DNAJC16 PE=2 SV=3 29 101 2.0E-06
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 39 101 2.0E-06
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 39 101 2.0E-06
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 39 101 2.0E-06
sp|Q2KI83|DJC17_BOVIN DnaJ homolog subfamily C member 17 OS=Bos taurus GN=DNAJC17 PE=2 SV=1 36 100 3.0E-06
sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 39 100 3.0E-06
sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 39 100 6.0E-06
sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 39 100 6.0E-06
sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=1 SV=3 39 100 8.0E-06
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 39 101 8.0E-06
sp|F1RTY8|DNJ5B_PIG DnaJ homolog subfamily C member 5B OS=Sus scrofa GN=DNAJC5B PE=3 SV=1 41 141 8.0E-06
sp|Q2KIJ8|DNJ5B_BOVIN DnaJ homolog subfamily C member 5B OS=Bos taurus GN=DNAJC5B PE=2 SV=1 41 141 8.0E-06
sp|Q39079|DNJ13_ARATH Chaperone protein dnaJ 13 OS=Arabidopsis thaliana GN=ATJ13 PE=1 SV=2 41 100 8.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4921 0.5646 0.005 0.0671 0.0697 0.0074 0.4069 0.0136 0.177 0.0019

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2679
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3675
Ophiocordyceps australis map64 (Brazil) OphauB2|1223
Ophiocordyceps camponoti-floridani Ophcf2|02770
Ophiocordyceps camponoti-rufipedis Ophun1|1850
Ophiocordyceps kimflemingae Ophio5|2243
Ophiocordyceps subramaniannii Hirsu2|4167 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4167
MATESANDDRDALDALELEAKEFDKDTEIDRILKAFRLDSYAVLDLQPGVADSDIKNTYRKKSLLIHPDKTKNPQ
APEAFDRLKKAQTELMDEKKRALLDEAIADARMLLIRENKWTVDSEELKTDEFAKMWRDKAKYVLIDNEHRRRRQ
VKAQMQEEGREQRKADAEMEERKRKRQHEQDWEATREQRIDSWRTFQKGKTGGEAADKKSKKKKLKPIG*
Coding >Hirsu2|4167
ATGGCTACCGAGAGCGCCAATGACGATCGAGATGCGCTCGATGCTCTCGAGCTGGAGGCCAAAGAGTTCGACAAG
GATACCGAGATCGATCGTATCCTCAAGGCATTTCGCCTGGACTCTTATGCCGTGCTCGACCTCCAACCCGGCGTG
GCCGACTCCGACATCAAGAACACGTACCGCAAGAAGTCGCTCCTGATCCACCCCGACAAGACGAAGAACCCGCAG
GCGCCCGAGGCCTTCGACCGGCTCAAGAAGGCGCAGACGGAGCTGATGGACGAGAAGAAGCGGGCGCTGCTGGAC
GAGGCCATCGCCGACGCCCGCATGCTGCTCATCCGGGAGAACAAGTGGACGGTGGACAGCGAGGAGCTCAAGACG
GACGAGTTCGCCAAGATGTGGCGCGACAAGGCCAAGTACGTGCTCATCGACAACGAGCACCGCCGTCGCCGCCAG
GTCAAGGCCCAGATGCAGGAGGAGGGCCGGGAGCAGCGCAAGGCCGACGCCGAGATGGAGGAGCGCAAGCGCAAG
AGGCAGCACGAGCAGGACTGGGAGGCCACGCGCGAGCAGCGCATAGACAGCTGGCGGACCTTCCAGAAGGGCAAG
ACCGGTGGCGAGGCCGCCGACAAGAAGAGCAAGAAGAAGAAGCTCAAGCCGATTGGCTGA
Transcript >Hirsu2|4167
ATGGCTACCGAGAGCGCCAATGACGATCGAGATGCGCTCGATGCTCTCGAGCTGGAGGCCAAAGAGTTCGACAAG
GATACCGAGATCGATCGTATCCTCAAGGCATTTCGCCTGGACTCTTATGCCGTGCTCGACCTCCAACCCGGCGTG
GCCGACTCCGACATCAAGAACACGTACCGCAAGAAGTCGCTCCTGATCCACCCCGACAAGACGAAGAACCCGCAG
GCGCCCGAGGCCTTCGACCGGCTCAAGAAGGCGCAGACGGAGCTGATGGACGAGAAGAAGCGGGCGCTGCTGGAC
GAGGCCATCGCCGACGCCCGCATGCTGCTCATCCGGGAGAACAAGTGGACGGTGGACAGCGAGGAGCTCAAGACG
GACGAGTTCGCCAAGATGTGGCGCGACAAGGCCAAGTACGTGCTCATCGACAACGAGCACCGCCGTCGCCGCCAG
GTCAAGGCCCAGATGCAGGAGGAGGGCCGGGAGCAGCGCAAGGCCGACGCCGAGATGGAGGAGCGCAAGCGCAAG
AGGCAGCACGAGCAGGACTGGGAGGCCACGCGCGAGCAGCGCATAGACAGCTGGCGGACCTTCCAGAAGGGCAAG
ACCGGTGGCGAGGCCGCCGACAAGAAGAGCAAGAAGAAGAAGCTCAAGCCGATTGGCTGA
Gene >Hirsu2|4167
ATGGCTACCGAGAGCGCCAATGACGATCGAGATGCGCTCGATGCTCTCGAGCTGGAGGCCAAAGAGTTCGACAAG
GTGCGGCTCGCGCCACCTGCGCATTTCCGGTGCCCGCTGCTGACGACCAAATTGCTACTTCCAGGATACCGAGAT
CGATCGTATCCTCAAGGCATTTCGCCTGGACTCGTAAACCTCCCCCCTNNNNNNNNNNNNNNNNNNNNNNNCCCC
CCCCCCCCCCCTCGGGCACTACCGTCTTCCCCCGCCCGTGCTGCGTCGTGGCTGACGAGGAATATGTGACACTCC
AGTTATGCCGTGCTCGACCTCCAACCCGGCGTGGCCGACTCCGACATCAAGAACACGTACCGCAAGAAGTCGCTC
CTGATCCACCCCGACAAGACGAAGAACCCGCAGGCGCCCGAGGCCTTCGACCGGCTCAAGAAGGCGCAGACGGAG
CTGATGGACGAGAAGAAGCGGGCGCTGCTGGACGAGGCCATCGCCGACGCCCGCATGCTGCTCATCCGGGAGAAC
AAGTGGACGGTGGACAGCGAGGAGCTCAAGACGGACGAGTTCGCCAAGATGTGGCGCGACAAGGCCAAGTACGTG
CTCATCGACAACGAGCACCGCCGTCGCCGCCAGGTCAAGGCCCAGATGCAGGAGGAGGGCCGGGAGCAGCGCAAG
GCCGACGCCGAGATGGAGGAGCGCAAGCGCAAGAGGCAGCACGAGCAGGACTGGGAGGCCACGCGCGAGCAGCGC
ATAGACAGCTGGCGGACCTTCCAGAAGGGCAAGACCGGTGGCGAGGCCGCCGACAAGAAGAGCAAGAAGAAGAAG
CTCAAGCCGATTGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail