Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4167
Gene name
LocationContig_2148:787..1630
Strand+
Gene length (bp)843
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 4.5E-15 39 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74746|SPF31_SCHPO J domain-containing protein spf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spf31 PE=3 SV=1 23 196 5.0E-39
sp|O75937|DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens GN=DNAJC8 PE=1 SV=2 36 202 4.0E-14
sp|Q642C0|DNJC8_RAT DnaJ homolog subfamily C member 8 OS=Rattus norvegicus GN=Dnajc8 PE=2 SV=1 36 202 8.0E-14
sp|Q6NZB0|DNJC8_MOUSE DnaJ homolog subfamily C member 8 OS=Mus musculus GN=Dnajc8 PE=1 SV=2 36 202 8.0E-14
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 39 101 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74746|SPF31_SCHPO J domain-containing protein spf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spf31 PE=3 SV=1 23 196 5.0E-39
sp|O75937|DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens GN=DNAJC8 PE=1 SV=2 36 202 4.0E-14
sp|Q642C0|DNJC8_RAT DnaJ homolog subfamily C member 8 OS=Rattus norvegicus GN=Dnajc8 PE=2 SV=1 36 202 8.0E-14
sp|Q6NZB0|DNJC8_MOUSE DnaJ homolog subfamily C member 8 OS=Mus musculus GN=Dnajc8 PE=1 SV=2 36 202 8.0E-14
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 39 101 1.0E-09
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 39 101 1.0E-09
sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 39 101 2.0E-09
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 39 101 2.0E-08
sp|Q9FH28|DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana GN=ATJ49 PE=2 SV=2 39 102 2.0E-07
sp|Q9NVM6|DJC17_HUMAN DnaJ homolog subfamily C member 17 OS=Homo sapiens GN=DNAJC17 PE=1 SV=1 36 100 5.0E-07
sp|Q0WT48|DNJ21_ARATH DnaJ protein ERDJ2A OS=Arabidopsis thaliana GN=ERDJ2A PE=1 SV=1 38 96 5.0E-07
sp|Q91WT4|DJC17_MOUSE DnaJ homolog subfamily C member 17 OS=Mus musculus GN=Dnajc17 PE=1 SV=2 36 100 5.0E-07
sp|O13633|YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi041 PE=1 SV=1 29 105 8.0E-07
sp|D2H417|DNJ5B_AILME DnaJ homolog subfamily C member 5B OS=Ailuropoda melanoleuca GN=DNAJC5B PE=3 SV=1 41 141 1.0E-06
sp|Q5RCM7|DJC16_PONAB DnaJ homolog subfamily C member 16 OS=Pongo abelii GN=DNAJC16 PE=2 SV=1 29 101 1.0E-06
sp|Q5UP23|YR260_MIMIV DnaJ-like protein R260 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R260 PE=3 SV=1 39 101 2.0E-06
sp|Q9Y2G8|DJC16_HUMAN DnaJ homolog subfamily C member 16 OS=Homo sapiens GN=DNAJC16 PE=2 SV=3 29 101 2.0E-06
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 39 101 2.0E-06
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 39 101 2.0E-06
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 39 101 2.0E-06
sp|Q2KI83|DJC17_BOVIN DnaJ homolog subfamily C member 17 OS=Bos taurus GN=DNAJC17 PE=2 SV=1 36 100 3.0E-06
sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 39 100 3.0E-06
sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 39 100 6.0E-06
sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 39 100 6.0E-06
sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=1 SV=3 39 100 8.0E-06
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 39 101 8.0E-06
sp|F1RTY8|DNJ5B_PIG DnaJ homolog subfamily C member 5B OS=Sus scrofa GN=DNAJC5B PE=3 SV=1 41 141 8.0E-06
sp|Q2KIJ8|DNJ5B_BOVIN DnaJ homolog subfamily C member 5B OS=Bos taurus GN=DNAJC5B PE=2 SV=1 41 141 8.0E-06
sp|Q39079|DNJ13_ARATH Chaperone protein dnaJ 13 OS=Arabidopsis thaliana GN=ATJ13 PE=1 SV=2 41 100 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4167
MATESANDDRDALDALELEAKEFDKDTEIDRILKAFRLDSYAVLDLQPGVADSDIKNTYRKKSLLIHPDKTKNPQ
APEAFDRLKKAQTELMDEKKRALLDEAIADARMLLIRENKWTVDSEELKTDEFAKMWRDKAKYVLIDNEHRRRRQ
VKAQMQEEGREQRKADAEMEERKRKRQHEQDWEATREQRIDSWRTFQKGKTGGEAADKKSKKKKLKPIG*
Coding >Hirsu2|4167
ATGGCTACCGAGAGCGCCAATGACGATCGAGATGCGCTCGATGCTCTCGAGCTGGAGGCCAAAGAGTTCGACAAG
GATACCGAGATCGATCGTATCCTCAAGGCATTTCGCCTGGACTCTTATGCCGTGCTCGACCTCCAACCCGGCGTG
GCCGACTCCGACATCAAGAACACGTACCGCAAGAAGTCGCTCCTGATCCACCCCGACAAGACGAAGAACCCGCAG
GCGCCCGAGGCCTTCGACCGGCTCAAGAAGGCGCAGACGGAGCTGATGGACGAGAAGAAGCGGGCGCTGCTGGAC
GAGGCCATCGCCGACGCCCGCATGCTGCTCATCCGGGAGAACAAGTGGACGGTGGACAGCGAGGAGCTCAAGACG
GACGAGTTCGCCAAGATGTGGCGCGACAAGGCCAAGTACGTGCTCATCGACAACGAGCACCGCCGTCGCCGCCAG
GTCAAGGCCCAGATGCAGGAGGAGGGCCGGGAGCAGCGCAAGGCCGACGCCGAGATGGAGGAGCGCAAGCGCAAG
AGGCAGCACGAGCAGGACTGGGAGGCCACGCGCGAGCAGCGCATAGACAGCTGGCGGACCTTCCAGAAGGGCAAG
ACCGGTGGCGAGGCCGCCGACAAGAAGAGCAAGAAGAAGAAGCTCAAGCCGATTGGCTGA
Transcript >Hirsu2|4167
ATGGCTACCGAGAGCGCCAATGACGATCGAGATGCGCTCGATGCTCTCGAGCTGGAGGCCAAAGAGTTCGACAAG
GATACCGAGATCGATCGTATCCTCAAGGCATTTCGCCTGGACTCTTATGCCGTGCTCGACCTCCAACCCGGCGTG
GCCGACTCCGACATCAAGAACACGTACCGCAAGAAGTCGCTCCTGATCCACCCCGACAAGACGAAGAACCCGCAG
GCGCCCGAGGCCTTCGACCGGCTCAAGAAGGCGCAGACGGAGCTGATGGACGAGAAGAAGCGGGCGCTGCTGGAC
GAGGCCATCGCCGACGCCCGCATGCTGCTCATCCGGGAGAACAAGTGGACGGTGGACAGCGAGGAGCTCAAGACG
GACGAGTTCGCCAAGATGTGGCGCGACAAGGCCAAGTACGTGCTCATCGACAACGAGCACCGCCGTCGCCGCCAG
GTCAAGGCCCAGATGCAGGAGGAGGGCCGGGAGCAGCGCAAGGCCGACGCCGAGATGGAGGAGCGCAAGCGCAAG
AGGCAGCACGAGCAGGACTGGGAGGCCACGCGCGAGCAGCGCATAGACAGCTGGCGGACCTTCCAGAAGGGCAAG
ACCGGTGGCGAGGCCGCCGACAAGAAGAGCAAGAAGAAGAAGCTCAAGCCGATTGGCTGA
Gene >Hirsu2|4167
ATGGCTACCGAGAGCGCCAATGACGATCGAGATGCGCTCGATGCTCTCGAGCTGGAGGCCAAAGAGTTCGACAAG
GTGCGGCTCGCGCCACCTGCGCATTTCCGGTGCCCGCTGCTGACGACCAAATTGCTACTTCCAGGATACCGAGAT
CGATCGTATCCTCAAGGCATTTCGCCTGGACTCGTAAACCTCCCCCCTNNNNNNNNNNNNNNNNNNNNNNNCCCC
CCCCCCCCCCCTCGGGCACTACCGTCTTCCCCCGCCCGTGCTGCGTCGTGGCTGACGAGGAATATGTGACACTCC
AGTTATGCCGTGCTCGACCTCCAACCCGGCGTGGCCGACTCCGACATCAAGAACACGTACCGCAAGAAGTCGCTC
CTGATCCACCCCGACAAGACGAAGAACCCGCAGGCGCCCGAGGCCTTCGACCGGCTCAAGAAGGCGCAGACGGAG
CTGATGGACGAGAAGAAGCGGGCGCTGCTGGACGAGGCCATCGCCGACGCCCGCATGCTGCTCATCCGGGAGAAC
AAGTGGACGGTGGACAGCGAGGAGCTCAAGACGGACGAGTTCGCCAAGATGTGGCGCGACAAGGCCAAGTACGTG
CTCATCGACAACGAGCACCGCCGTCGCCGCCAGGTCAAGGCCCAGATGCAGGAGGAGGGCCGGGAGCAGCGCAAG
GCCGACGCCGAGATGGAGGAGCGCAAGCGCAAGAGGCAGCACGAGCAGGACTGGGAGGCCACGCGCGAGCAGCGC
ATAGACAGCTGGCGGACCTTCCAGAAGGGCAAGACCGGTGGCGAGGCCGCCGACAAGAAGAGCAAGAAGAAGAAG
CTCAAGCCGATTGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail