Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4163
Gene name
LocationContig_2146:258..1697
Strand-
Gene length (bp)1439
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 4.5E-90 43 384

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9ERT9|CHI1_METRA Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chit1 PE=3 SV=1 1 424 0.0E+00
sp|P32470|CHI1_APHAL Chitinase 1 OS=Aphanocladium album GN=CHI1 PE=1 SV=2 1 423 0.0E+00
sp|O14456|CHI1_METAN Endochitinase 1 OS=Metarhizium anisopliae GN=chit1 PE=1 SV=1 1 424 0.0E+00
sp|P48827|CHI42_TRIHA Endochitinase 42 OS=Trichoderma harzianum GN=chit42 PE=1 SV=1 29 423 0.0E+00
sp|A6N6J0|CHI46_TRIHA Endochitinase 46 OS=Trichoderma harzianum GN=chit46 PE=1 SV=1 1 423 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9ERT9|CHI1_METRA Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=chit1 PE=3 SV=1 1 424 0.0E+00
sp|P32470|CHI1_APHAL Chitinase 1 OS=Aphanocladium album GN=CHI1 PE=1 SV=2 1 423 0.0E+00
sp|O14456|CHI1_METAN Endochitinase 1 OS=Metarhizium anisopliae GN=chit1 PE=1 SV=1 1 424 0.0E+00
sp|P48827|CHI42_TRIHA Endochitinase 42 OS=Trichoderma harzianum GN=chit42 PE=1 SV=1 29 423 0.0E+00
sp|A6N6J0|CHI46_TRIHA Endochitinase 46 OS=Trichoderma harzianum GN=chit46 PE=1 SV=1 1 423 0.0E+00
sp|E9QRF2|CHIB1_ASPFU Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiB1 PE=3 SV=1 8 423 2.0E-157
sp|Q873X9|CHIB1_ASPFM Endochitinase B1 OS=Neosartorya fumigata GN=chiB1 PE=1 SV=1 8 423 2.0E-157
sp|C5P230|CHI1_COCP7 Endochitinase 1 OS=Coccidioides posadasii (strain C735) GN=CTS1 PE=3 SV=1 8 423 4.0E-150
sp|Q1E3R8|CHI1_COCIM Endochitinase 1 OS=Coccidioides immitis (strain RS) GN=CTS1 PE=3 SV=1 8 423 8.0E-150
sp|P0CB51|CHI1_COCPS Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=CTS1 PE=1 SV=1 8 423 3.0E-149
sp|Q92222|CHIB_EMEND Endochitinase B OS=Emericella nidulans GN=chiB PE=1 SV=3 37 423 1.0E-143
sp|G5EAZ3|CHIB1_EMENI Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chiB PE=1 SV=1 37 423 1.0E-143
sp|P20533|CHIA1_BACCI Chitinase A1 OS=Bacillus circulans GN=chiA1 PE=1 SV=1 44 385 6.0E-66
sp|Q5AM60|CHI4_CANAL Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT4 PE=3 SV=1 39 403 1.0E-64
sp|Q06350|CHI2_YEAST Sporulation-specific chitinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTS2 PE=1 SV=1 35 399 7.0E-55
sp|P41684|CHIT_NPVAC Probable endochitinase OS=Autographa californica nuclear polyhedrosis virus PE=3 SV=1 44 387 3.0E-49
sp|O10363|CHIT_NPVOP Probable endochitinase OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=ORF124 PE=3 SV=1 42 387 2.0E-47
sp|P07254|CHIA_SERMA Chitinase A OS=Serratia marcescens GN=chiA PE=1 SV=3 34 400 4.0E-46
sp|P36909|CHIT_STRLI Chitinase C OS=Streptomyces lividans GN=chiC PE=2 SV=1 44 388 1.0E-45
sp|P32823|CHIA_PSEO7 Chitinase A OS=Pseudoalteromonas piscicida GN=chiA PE=1 SV=1 38 387 2.0E-44
sp|P11220|CHIT_STRPL Chitinase 63 OS=Streptomyces plicatus GN=chtA PE=1 SV=2 44 399 1.0E-43
sp|Q13231|CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens GN=CHIT1 PE=1 SV=1 43 399 3.0E-43
sp|Q95M17|CHIA_BOVIN Acidic mammalian chitinase OS=Bos taurus GN=CHIA PE=1 SV=1 34 407 2.0E-40
sp|Q11174|CHIT_CAEEL Probable endochitinase OS=Caenorhabditis elegans GN=cht-1 PE=1 SV=1 21 402 3.0E-38
sp|P11797|CHIB_SERMA Chitinase B OS=Serratia marcescens GN=chiB PE=1 SV=1 54 417 3.0E-37
sp|Q9BZP6|CHIA_HUMAN Acidic mammalian chitinase OS=Homo sapiens GN=CHIA PE=1 SV=1 34 405 4.0E-37
sp|Q9WTV1|CH3L1_RAT Chitinase-3-like protein 1 OS=Rattus norvegicus GN=Chi3l1 PE=2 SV=3 34 384 7.0E-36
sp|Q91XA9|CHIA_MOUSE Acidic mammalian chitinase OS=Mus musculus GN=Chia PE=1 SV=2 43 400 8.0E-36
sp|Q9D7Q1|CHIT1_MOUSE Chitotriosidase-1 OS=Mus musculus GN=Chit1 PE=1 SV=2 43 399 7.0E-35
sp|P36222|CH3L1_HUMAN Chitinase-3-like protein 1 OS=Homo sapiens GN=CHI3L1 PE=1 SV=2 36 388 2.0E-34
sp|A5FB63|CHIA_FLAJ1 Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=chiA PE=1 SV=1 28 386 4.0E-34
sp|Q5RBP6|CH3L1_PONAB Chitinase-3-like protein 1 OS=Pongo abelii GN=CHI3L1 PE=2 SV=1 36 388 7.0E-34
sp|P36362|CHIT_MANSE Endochitinase OS=Manduca sexta PE=2 SV=1 43 419 1.0E-33
sp|Q6RY07|CHIA_RAT Acidic mammalian chitinase OS=Rattus norvegicus GN=Chia PE=2 SV=1 34 399 1.0E-33
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 35 384 9.0E-33
sp|Q6TMG6|CH3L1_SHEEP Chitinase-3-like protein 1 OS=Ovis aries GN=CHI3L1 PE=1 SV=1 43 384 1.0E-32
sp|Q9W092|CHIT2_DROME Probable chitinase 2 OS=Drosophila melanogaster GN=Cht2 PE=1 SV=1 43 384 2.0E-32
sp|P30922|CH3L1_BOVIN Chitinase-3-like protein 1 OS=Bos taurus GN=CHI3L1 PE=1 SV=3 43 384 2.0E-32
sp|Q29411|CH3L1_PIG Chitinase-3-like protein 1 OS=Sus scrofa GN=CHI3L1 PE=1 SV=2 43 384 4.0E-32
sp|Q7YS85|CH3L1_BUBBU Chitinase-3-like protein 1 OS=Bubalus bubalis GN=CHI3L1 PE=1 SV=3 43 384 1.0E-31
sp|Q61362|CH3L1_MOUSE Chitinase-3-like protein 1 OS=Mus musculus GN=Chi3l1 PE=1 SV=3 34 388 1.0E-31
sp|Q8SPQ0|CH3L1_CAPHI Chitinase-3-like protein 1 OS=Capra hircus GN=CHI3L1 PE=1 SV=1 43 384 5.0E-31
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 36 384 1.0E-30
sp|P36718|OVGP1_PAPAN Oviduct-specific glycoprotein OS=Papio anubis GN=OVGP1 PE=2 SV=2 43 388 2.0E-27
sp|Q15782|CH3L2_HUMAN Chitinase-3-like protein 2 OS=Homo sapiens GN=CHI3L2 PE=1 SV=1 37 402 2.0E-27
sp|Q28542|OVGP1_SHEEP Oviduct-specific glycoprotein OS=Ovis aries GN=OVGP1 PE=1 SV=1 43 384 3.0E-27
sp|Q12889|OVGP1_HUMAN Oviduct-specific glycoprotein OS=Homo sapiens GN=OVGP1 PE=2 SV=1 43 388 5.0E-27
sp|Q62010|OVGP1_MOUSE Oviduct-specific glycoprotein OS=Mus musculus GN=Ovgp1 PE=2 SV=1 43 388 7.0E-27
sp|Q28042|OVGP1_BOVIN Oviduct-specific glycoprotein (Fragment) OS=Bos taurus GN=OVGP1 PE=1 SV=1 43 384 1.0E-26
sp|P29030|CHIT_BRUMA Endochitinase OS=Brugia malayi PE=1 SV=1 38 405 2.0E-26
sp|Q60557|OVGP1_MESAU Oviduct-specific glycoprotein OS=Mesocricetus auratus GN=OVGP1 PE=1 SV=1 43 388 5.0E-26
sp|Q91Z98|CHIL4_MOUSE Chitinase-like protein 4 OS=Mus musculus GN=Chil4 PE=1 SV=2 37 405 4.0E-25
sp|O35744|CHIL3_MOUSE Chitinase-like protein 3 OS=Mus musculus GN=Chil3 PE=1 SV=2 34 405 2.0E-24
sp|H2A0L4|CHI1_PINMG Putative chitinase 1 OS=Pinctada margaritifera PE=1 SV=1 36 388 2.0E-23
sp|Q28990|OVGP1_PIG Oviduct-specific glycoprotein OS=Sus scrofa GN=OVGP1 PE=2 SV=1 43 384 4.0E-23
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 43 384 8.0E-23
sp|P96156|CHID_VIBFU Chitodextrinase OS=Vibrio furnissii GN=endo I PE=1 SV=1 29 384 2.0E-22
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 43 404 3.0E-21
sp|P86955|CHI_PINMA Putative chitinase OS=Pinctada maxima PE=1 SV=1 39 388 2.0E-19
sp|H2A0L5|CHI2_PINMG Putative chitinase 2 OS=Pinctada margaritifera PE=1 SV=1 39 388 9.0E-19
sp|P09805|KTXA_KLULA Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) PE=1 SV=1 123 299 6.0E-15
sp|Q5AKZ3|CHI5_CANAL Probable chitinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.12451 PE=3 SV=1 117 308 3.0E-12
sp|Q9V3D4|IDGF2_DROME Chitinase-like protein Idgf2 OS=Drosophila melanogaster GN=Idgf2 PE=1 SV=1 65 305 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4163
MPSVLAKSLAILASAYSTLGLAAAVQRAESASEKRASGFANSVYFTNWGIYGRNYQPADLPASEISHVLYSFMNL
RADGTIYSGDTYADLEKHYPGDSWNDIGKNAYGCVKQLFLLKKANRHTKLMLSIGGWTWSTNFPAAASSPATRSN
FAKSAVNFVKDWGFDGIDIDWEYPADDAQAGNMVLLLQAVRDELDAYAAKSAPGYHFELSIAAPAGPDHYKRLHM
AELGRLLDHVNLMAYDFAGSWSNYSGHDANLYANPNNPNATPFNTDDAVQAYIKGGIAAEKIVLGMPIYGRSFQS
TDGVGKTYKGIGSGTWENGVWDYKALPKAGAKVAYDDIAKGYYSYDDKTKELISFDTPEMIQDKVKYLKGKGMGG
AMFWEASADRKDGGSLISTSHQALGALDSSQNWLSYPESQYENVKKGMA*
Coding >Hirsu2|4163
ATGCCATCCGTGCTTGCGAAATCGCTAGCCATTCTCGCCTCGGCGTATTCGACACTGGGCTTGGCCGCGGCGGTG
CAGCGGGCTGAAAGCGCCTCCGAGAAGCGCGCAAGCGGGTTTGCCAATTCGGTCTACTTCACGAACTGGGGCATA
TACGGCCGCAATTACCAACCTGCCGATCTTCCTGCTTCTGAAATCAGTCATGTGCTTTACTCGTTCATGAATCTC
CGCGCCGATGGGACCATTTATTCGGGAGACACTTACGCAGATCTTGAGAAGCATTACCCTGGGGACTCTTGGAAT
GACATCGGGAAAAATGCGTACGGTTGTGTGAAGCAGCTGTTCTTACTGAAGAAGGCAAATCGACACACAAAGCTA
ATGCTCTCAATTGGTGGTTGGACGTGGTCAACTAACTTCCCGGCCGCCGCGTCGAGCCCTGCTACTCGCTCCAAC
TTTGCTAAGTCTGCCGTCAATTTTGTCAAGGATTGGGGGTTCGACGGCATAGATATCGACTGGGAATACCCGGCT
GATGACGCGCAAGCCGGCAACATGGTGCTTCTGCTTCAGGCAGTGCGTGACGAGCTAGACGCTTACGCTGCCAAA
TCTGCGCCAGGTTACCACTTCGAACTGTCCATTGCTGCCCCAGCTGGCCCAGATCACTACAAGAGACTGCATATG
GCGGAGCTTGGTCGGCTACTTGACCACGTCAACCTGATGGCATATGACTTTGCTGGTTCTTGGAGCAACTATAGT
GGGCATGACGCCAACTTATATGCCAATCCAAATAACCCCAATGCTACACCCTTCAACACAGATGACGCTGTCCAG
GCTTACATCAAAGGCGGTATCGCCGCCGAAAAGATTGTGCTGGGGATGCCTATCTACGGCCGATCATTTCAATCC
ACAGATGGCGTCGGCAAGACATATAAGGGCATCGGCAGCGGTACCTGGGAAAATGGCGTCTGGGACTATAAGGCT
CTCCCGAAGGCCGGTGCTAAGGTGGCATACGATGACATAGCTAAGGGCTACTACAGCTACGACGATAAGACCAAG
GAGCTGATCTCCTTTGATACGCCAGAAATGATTCAGGACAAGGTCAAATACTTAAAGGGCAAAGGGATGGGCGGT
GCCATGTTTTGGGAAGCCTCTGCTGATCGCAAAGACGGTGGCTCTCTTATCAGTACCAGCCATCAGGCTTTAGGT
GCACTTGACTCGTCCCAAAACTGGCTCAGCTACCCCGAATCACAGTACGAGAACGTTAAGAAAGGGATGGCTTGA
Transcript >Hirsu2|4163
ATGCCATCCGTGCTTGCGAAATCGCTAGCCATTCTCGCCTCGGCGTATTCGACACTGGGCTTGGCCGCGGCGGTG
CAGCGGGCTGAAAGCGCCTCCGAGAAGCGCGCAAGCGGGTTTGCCAATTCGGTCTACTTCACGAACTGGGGCATA
TACGGCCGCAATTACCAACCTGCCGATCTTCCTGCTTCTGAAATCAGTCATGTGCTTTACTCGTTCATGAATCTC
CGCGCCGATGGGACCATTTATTCGGGAGACACTTACGCAGATCTTGAGAAGCATTACCCTGGGGACTCTTGGAAT
GACATCGGGAAAAATGCGTACGGTTGTGTGAAGCAGCTGTTCTTACTGAAGAAGGCAAATCGACACACAAAGCTA
ATGCTCTCAATTGGTGGTTGGACGTGGTCAACTAACTTCCCGGCCGCCGCGTCGAGCCCTGCTACTCGCTCCAAC
TTTGCTAAGTCTGCCGTCAATTTTGTCAAGGATTGGGGGTTCGACGGCATAGATATCGACTGGGAATACCCGGCT
GATGACGCGCAAGCCGGCAACATGGTGCTTCTGCTTCAGGCAGTGCGTGACGAGCTAGACGCTTACGCTGCCAAA
TCTGCGCCAGGTTACCACTTCGAACTGTCCATTGCTGCCCCAGCTGGCCCAGATCACTACAAGAGACTGCATATG
GCGGAGCTTGGTCGGCTACTTGACCACGTCAACCTGATGGCATATGACTTTGCTGGTTCTTGGAGCAACTATAGT
GGGCATGACGCCAACTTATATGCCAATCCAAATAACCCCAATGCTACACCCTTCAACACAGATGACGCTGTCCAG
GCTTACATCAAAGGCGGTATCGCCGCCGAAAAGATTGTGCTGGGGATGCCTATCTACGGCCGATCATTTCAATCC
ACAGATGGCGTCGGCAAGACATATAAGGGCATCGGCAGCGGTACCTGGGAAAATGGCGTCTGGGACTATAAGGCT
CTCCCGAAGGCCGGTGCTAAGGTGGCATACGATGACATAGCTAAGGGCTACTACAGCTACGACGATAAGACCAAG
GAGCTGATCTCCTTTGATACGCCAGAAATGATTCAGGACAAGGTCAAATACTTAAAGGGCAAAGGGATGGGCGGT
GCCATGTTTTGGGAAGCCTCTGCTGATCGCAAAGACGGTGGCTCTCTTATCAGTACCAGCCATCAGGCTTTAGGT
GCACTTGACTCGTCCCAAAACTGGCTCAGCTACCCCGAATCACAGTACGAGAACGTTAAGAAAGGGATGGCTTGA
Gene >Hirsu2|4163
ATGCCATCCGTGCTTGCGAAATCGCTAGCCATTCTCGCCTCGGCGTATTCGACACTGGGCTTGGCCGCGGCGGTG
CAGCGGGCTGAAAGCGCCTCCGAGAAGCGCGCAAGCGGGTTTGCCAATTCGGTCTACTTCACGAACTGGTACGTC
AAGCCCCACCACGGCCCTCAACAATCTATGATTAAGTGGTTTACAGGGGCATATACGGCCGCAATTACCAACCTG
CCGATCTTCCTGCTTCTGAAATCAGTCATGTGCTTTACTCGTTCATGAATCTCCGCGCCGATGGGACCATGTGAG
TATAGACTCTACGTGACGTCGAGGCTTGATTTCTCATGGCGCCACCAGTTATTCGGGAGACACTTACGCAGATCT
TGAGAAGCATTACCCTGGGGACTGTCGGTCTTATCCCACGAAAACCTGGCGGAGAATTGACTAGCTAACTGCGAT
CCACAGCTTGGAATGACATCGGGAAAAATGCGTACGGTTGTGTGAAGCAGCTGTTCTTACTGAAGAAGGCAAATC
GACACACAAAGCTAATGCTCTCAATTGGTGGTTGGACGTGGTCAACTAACTTCCCGGCCGCCGCGTCGAGCCCTG
CTACTCGCTCCAACTTTGCTAAGTCTGCCGTCAATTTTGTCAAGGATTGGGGGTTCGACGGCATAGATATCGACT
GGGAATACCCGGCTGATGACGCGCAAGCCGGCAACATGGTGCTTCTGCTTCAGGCAGTGCGTGACGAGCTAGACG
CTTACGCTGCCAAATCTGCGCCAGGTTACCACTTCGAACTGTCCATTGCTGCCCCAGCTGGCCCAGATCACTACA
AGAGACTGCATATGGCGGAGCTTGGTCGGCTACTTGACCACGTCAACCTGATGGCATATGACTTTGCTGGTTCTT
GGAGCAACTATAGTGGGCATGACGCCAACTTATATGCCAATCCAAATAACCCCAATGCTACACCCTTCAACACAG
ATGACGCTGTCCAGGCTTACATCAAAGGCGGTATCGCCGCCGAAAAGATTGTGCTGGGGATGCCTATCTACGGCC
GATCATTTCAATCCACAGATGGCGTCGGCAAGACATATAAGGGCATCGGCAGCGGTACCTGGGAAAATGGCGTCT
GGGACTATAAGGCTCTCCCGAAGGCCGGTGCTAAGGTGGCATACGATGACATAGCTAAGGGCTACTACAGCTACG
ACGATAAGACCAAGGAGCTGATCTCCTTTGATACGCCAGAAATGATTCAGGACAAGGTCAAATACTTAAAGGGCA
AAGGGATGGGCGGTGCCATGTTTTGGGAAGCCTCTGCTGATCGCAAAGACGGTGGCTCTCTTATCAGTACCAGCC
ATCAGGCTTTAGGTGCACTTGACTCGTCCCAAAACTGGCTCAGCTACCCCGAATCACAGTACGAGAACGTTAAGA
AAGGGATGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail