Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|416
Gene name
LocationContig_1082:6331..7236
Strand+
Gene length (bp)905
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 109 128 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|416
MDRVWLTVFLSLVLRFASAAPAHAVNETNTSVQKDEPSWESGPHTRGTLGLFFSCVITLFLCVWTTVHVNIEPTN
EMNYRFSKLCGFAIPYLSNRDLGKILVKSWVRKLGWGLVTLIVPEGSMAIATYERRTAKLLREKMNEIKKDEKEW
DMSLAYYAVMGGFVIPEDVYDDVKVEKEKEKEKNKDERDEKVDIHENKTLTLTPYGVLQVAEWEKGGPPLLCITS
EEVRDKGNASSVAKVLVFWQVFWMILQVIGRAVTRLPVTLLELHTVLHTFCAS*
Coding >Hirsu2|416
ATGGATAGAGTCTGGCTTACGGTCTTCCTTTCACTCGTCCTTCGATTCGCGAGCGCCGCGCCAGCGCACGCTGTC
AACGAGACGAACACGTCCGTCCAAAAGGACGAACCGTCGTGGGAATCAGGACCTCACACGCGTGGCACCCTGGGT
CTTTTCTTTAGCTGCGTCATCACATTGTTCCTCTGCGTCTGGACCACGGTCCATGTCAACATCGAGCCGACAAAC
GAGATGAACTACAGGTTCAGCAAGCTCTGTGGCTTCGCCATTCCGTATCTCAGCAATAGAGACCTTGGCAAAATT
CTGGTCAAGTCATGGGTCCGGAAGCTCGGCTGGGGTCTTGTAACCCTTATTGTACCTGAAGGCTCGATGGCCATT
GCGACATACGAGAGAAGAACCGCCAAACTCCTCCGCGAAAAGATGAACGAAATCAAGAAGGATGAGAAGGAGTGG
GACATGTCACTAGCTTATTACGCTGTCATGGGAGGGTTTGTCATTCCGGAAGATGTCTATGACGACGTCAAGGTG
GAGAAGGAGAAGGAGAAGGAGAAGAACAAGGACGAAAGAGACGAAAAGGTGGACATTCATGAAAACAAGACTCTT
ACTCTTACCCCTTACGGAGTCCTTCAGGTGGCAGAGTGGGAGAAGGGTGGGCCCCCGCTGCTGTGCATTACATCC
GAAGAGGTGCGTGACAAGGGCAATGCCAGCTCTGTTGCGAAAGTCCTCGTTTTCTGGCAGGTGTTTTGGATGATA
CTCCAGGTCATCGGCCGGGCCGTTACGAGGTTACCTGTGACGCTGCTCGAGCTACATACCGTCTTGCACACATTC
TGTGCGTCATGA
Transcript >Hirsu2|416
ATGGATAGAGTCTGGCTTACGGTCTTCCTTTCACTCGTCCTTCGATTCGCGAGCGCCGCGCCAGCGCACGCTGTC
AACGAGACGAACACGTCCGTCCAAAAGGACGAACCGTCGTGGGAATCAGGACCTCACACGCGTGGCACCCTGGGT
CTTTTCTTTAGCTGCGTCATCACATTGTTCCTCTGCGTCTGGACCACGGTCCATGTCAACATCGAGCCGACAAAC
GAGATGAACTACAGGTTCAGCAAGCTCTGTGGCTTCGCCATTCCGTATCTCAGCAATAGAGACCTTGGCAAAATT
CTGGTCAAGTCATGGGTCCGGAAGCTCGGCTGGGGTCTTGTAACCCTTATTGTACCTGAAGGCTCGATGGCCATT
GCGACATACGAGAGAAGAACCGCCAAACTCCTCCGCGAAAAGATGAACGAAATCAAGAAGGATGAGAAGGAGTGG
GACATGTCACTAGCTTATTACGCTGTCATGGGAGGGTTTGTCATTCCGGAAGATGTCTATGACGACGTCAAGGTG
GAGAAGGAGAAGGAGAAGGAGAAGAACAAGGACGAAAGAGACGAAAAGGTGGACATTCATGAAAACAAGACTCTT
ACTCTTACCCCTTACGGAGTCCTTCAGGTGGCAGAGTGGGAGAAGGGTGGGCCCCCGCTGCTGTGCATTACATCC
GAAGAGGTGCGTGACAAGGGCAATGCCAGCTCTGTTGCGAAAGTCCTCGTTTTCTGGCAGGTGTTTTGGATGATA
CTCCAGGTCATCGGCCGGGCCGTTACGAGGTTACCTGTGACGCTGCTCGAGCTACATACCGTCTTGCACACATTC
TGTGCGTCATGA
Gene >Hirsu2|416
ATGGATAGAGTCTGGCTTACGGTCTTCCTTTCACTCGTCCTTCGATTCGCGAGCGCCGCGCCAGCGCACGCTGTC
AACGAGACGAACACGTCCGTCCAAAAGGACGAACCGTCGTGGGAATCAGGACCTCACACGCGTGGCACCCTGGGT
CTTTTCTTTAGCTGCGTCATCACATTGTTCCTCTGCGTCTGGACCACGGTCCATGTCAACATCGAGCCGACAAAC
GAGATGAACTACAGGTTCAGCAAGCTCTGTGGCTTCGCCATTCCGTATCTCAGCAATAGAGACCTTGGCAAAATT
CTGGTCAAGTCATGGGTCCGGAAGCTCGGCTGGGGTCTTGTAACCCTTATTGTACCTGAAGGCTCGATGGCCATT
GCGACATACGAGAGAAGAACCGCCAAACTCCTCCGCGAAAAGATGAACGAAATCAAGAAGGATGAGAAGGAGTGG
GACATGTCACTAGCTTATTACGCTGTCATGGGAGGGTTTGTCATTCCGGAAGATGTCTATGACGACGTCAAGGTG
GAGAAGGAGAAGGAGAAGGAGAAGAACAAGGACGAAAGAGACGAAAAGGTGGACATTCATGAAAACAAGACTCTT
ACTCTTACCCCTTACGGAGTCCTTCAGGTGGCAGAGTGGGAGAAGGGTGGGCCCCCGCTGCTGTGCATTACATCC
GAAGAGGTGCGTGACAAGGGCAATGCCAGCTCTGTTGCGAAAGTCCTCGTTTTCTGGCAGGTGTTTTGGATGATA
CTCCAGGTCATCGGCCGGGCCGTTACGAGGTTACCTGTGACGCTGCTCGAGCTACATACCGTCTTGCACACATTC
TGTGCGGTGGCTATGTACGCAACGTGGTGGAGCAAGCCAGTCGACATCGACAACCCAACCGTCGTTTCTCTCAGT
CATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail