Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4159
Gene name
LocationContig_2143:3127..3541
Strand-
Gene length (bp)414
Transcript length (bp)414
Coding sequence length (bp)414
Protein length (aa) 138

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain 2.8E-07 2 65

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y600|CSAD_HUMAN Cysteine sulfinic acid decarboxylase OS=Homo sapiens GN=CSAD PE=1 SV=2 2 136 6.0E-14
sp|Q9DBE0|CSAD_MOUSE Cysteine sulfinic acid decarboxylase OS=Mus musculus GN=Csad PE=1 SV=1 2 113 6.0E-13
sp|Q64611|CSAD_RAT Cysteine sulfinic acid decarboxylase OS=Rattus norvegicus GN=Csad PE=1 SV=1 2 136 1.0E-12
sp|Q05329|DCE2_HUMAN Glutamate decarboxylase 2 OS=Homo sapiens GN=GAD2 PE=1 SV=1 3 114 4.0E-10
sp|Q4PRC2|DCE2_CANLF Glutamate decarboxylase 2 OS=Canis lupus familiaris GN=GAD2 PE=2 SV=1 3 114 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y600|CSAD_HUMAN Cysteine sulfinic acid decarboxylase OS=Homo sapiens GN=CSAD PE=1 SV=2 2 136 6.0E-14
sp|Q9DBE0|CSAD_MOUSE Cysteine sulfinic acid decarboxylase OS=Mus musculus GN=Csad PE=1 SV=1 2 113 6.0E-13
sp|Q64611|CSAD_RAT Cysteine sulfinic acid decarboxylase OS=Rattus norvegicus GN=Csad PE=1 SV=1 2 136 1.0E-12
sp|Q05329|DCE2_HUMAN Glutamate decarboxylase 2 OS=Homo sapiens GN=GAD2 PE=1 SV=1 3 114 4.0E-10
sp|Q4PRC2|DCE2_CANLF Glutamate decarboxylase 2 OS=Canis lupus familiaris GN=GAD2 PE=2 SV=1 3 114 4.0E-10
sp|Q05683|DCE2_RAT Glutamate decarboxylase 2 OS=Rattus norvegicus GN=Gad2 PE=1 SV=1 3 114 4.0E-10
sp|P48320|DCE2_MOUSE Glutamate decarboxylase 2 OS=Mus musculus GN=Gad2 PE=1 SV=1 3 114 6.0E-10
sp|P48321|DCE2_PIG Glutamate decarboxylase 2 OS=Sus scrofa GN=GAD2 PE=2 SV=1 3 114 7.0E-10
sp|Q5R7S7|DCE1_PONAB Glutamate decarboxylase 1 OS=Pongo abelii GN=GAD1 PE=2 SV=1 3 136 8.0E-10
sp|Q99259|DCE1_HUMAN Glutamate decarboxylase 1 OS=Homo sapiens GN=GAD1 PE=1 SV=1 3 136 8.0E-10
sp|Q80WP8|GADL1_MOUSE Acidic amino acid decarboxylase GADL1 OS=Mus musculus GN=Gadl1 PE=1 SV=3 2 136 9.0E-10
sp|Q5IS68|DCE1_PANTR Glutamate decarboxylase 1 OS=Pan troglodytes GN=GAD1 PE=2 SV=1 3 136 9.0E-10
sp|P18088|DCE1_RAT Glutamate decarboxylase 1 OS=Rattus norvegicus GN=Gad1 PE=2 SV=1 3 136 1.0E-09
sp|P48319|DCE1_PIG Glutamate decarboxylase 1 OS=Sus scrofa GN=GAD1 PE=2 SV=1 3 136 1.0E-09
sp|P14748|DCE1_FELCA Glutamate decarboxylase 1 OS=Felis catus GN=GAD1 PE=2 SV=3 3 136 1.0E-09
sp|A0PA85|DCE1_CANLF Glutamate decarboxylase 1 OS=Canis lupus familiaris GN=GAD1 PE=2 SV=1 3 136 1.0E-09
sp|Q0VCA1|DCE1_BOVIN Glutamate decarboxylase 1 OS=Bos taurus GN=GAD1 PE=2 SV=1 3 136 1.0E-09
sp|P48318|DCE1_MOUSE Glutamate decarboxylase 1 OS=Mus musculus GN=Gad1 PE=1 SV=2 3 136 1.0E-09
sp|P20228|DCE_DROME Glutamate decarboxylase OS=Drosophila melanogaster GN=Gad1 PE=2 SV=2 3 132 2.0E-08
sp|A6QM00|GADL1_BOVIN Acidic amino acid decarboxylase GADL1 OS=Bos taurus GN=GADL1 PE=2 SV=2 2 136 2.0E-08
sp|Q6ZQY3|GADL1_HUMAN Acidic amino acid decarboxylase GADL1 OS=Homo sapiens GN=GADL1 PE=1 SV=4 2 136 1.0E-07
sp|Q28D99|GADL1_XENTR Acidic amino acid decarboxylase GADL1 (Fragment) OS=Xenopus tropicalis GN=gadl1 PE=2 SV=2 2 132 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016831 carboxy-lyase activity Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0019752 carboxylic acid metabolic process Yes
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0016829 lyase activity No
GO:0008152 metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0048037 cofactor binding No
GO:0050662 coenzyme binding No
GO:0006082 organic acid metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:0070279 vitamin B6 binding No
GO:0019842 vitamin binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0044281 small molecule metabolic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4159
LTLQCGRRGDSLKLALAWLYYGADGFERQIDHAFDMAALLHRRLASSANFHLLSADPPPCLQVCFYHAPAGALSD
DGPANTRRTRAIVERLVHRGFMVDYAPGDRGSFLRVVVNVQTLPATVDGLARALDEVASEMA*
Coding >Hirsu2|4159
CTGACGCTCCAGTGCGGCCGCCGCGGCGACAGCCTCAAGCTCGCCCTGGCCTGGCTCTACTACGGCGCCGACGGC
TTCGAGCGCCAGATCGACCACGCCTTCGACATGGCCGCCCTCCTGCACCGCCGCCTCGCCTCCTCCGCCAACTTC
CACCTGCTGTCCGCCGACCCGCCGCCCTGCCTGCAGGTCTGCTTCTACCACGCCCCGGCCGGCGCCCTGTCCGAC
GACGGGCCGGCCAACACGCGCCGCACCCGCGCCATCGTCGAGCGCCTGGTCCACCGCGGCTTCATGGTCGACTAC
GCCCCCGGCGACCGCGGGAGCTTCTTGCGCGTCGTCGTCAACGTCCAGACGCTGCCCGCCACCGTCGACGGCTTG
GCCCGAGCCCTGGACGAGGTCGCTTCCGAGATGGCCTGA
Transcript >Hirsu2|4159
CTGACGCTCCAGTGCGGCCGCCGCGGCGACAGCCTCAAGCTCGCCCTGGCCTGGCTCTACTACGGCGCCGACGGC
TTCGAGCGCCAGATCGACCACGCCTTCGACATGGCCGCCCTCCTGCACCGCCGCCTCGCCTCCTCCGCCAACTTC
CACCTGCTGTCCGCCGACCCGCCGCCCTGCCTGCAGGTCTGCTTCTACCACGCCCCGGCCGGCGCCCTGTCCGAC
GACGGGCCGGCCAACACGCGCCGCACCCGCGCCATCGTCGAGCGCCTGGTCCACCGCGGCTTCATGGTCGACTAC
GCCCCCGGCGACCGCGGGAGCTTCTTGCGCGTCGTCGTCAACGTCCAGACGCTGCCCGCCACCGTCGACGGCTTG
GCCCGAGCCCTGGACGAGGTCGCTTCCGAGATGGCCTGA
Gene >Hirsu2|4159
CTGACGCTCCAGTGCGGCCGCCGCGGCGACAGCCTCAAGCTCGCCCTGGCCTGGCTCTACTACGGCGCCGACGGC
TTCGAGCGCCAGATCGACCACGCCTTCGACATGGCCGCCCTCCTGCACCGCCGCCTCGCCTCCTCCGCCAACTTC
CACCTGCTGTCCGCCGACCCGCCGCCCTGCCTGCAGGTCTGCTTCTACCACGCCCCGGCCGGCGCCCTGTCCGAC
GACGGGCCGGCCAACACGCGCCGCACCCGCGCCATCGTCGAGCGCCTGGTCCACCGCGGCTTCATGGTCGACTAC
GCCCCCGGCGACCGCGGGAGCTTCTTGCGCGTCGTCGTCAACGTCCAGACGCTGCCCGCCACCGTCGACGGCTTG
GCCCGAGCCCTGGACGAGGTCGCTTCCGAGATGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail