Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4153
Gene name
LocationContig_214:25509..28431
Strand+
Gene length (bp)2922
Transcript length (bp)2778
Coding sequence length (bp)2778
Protein length (aa) 926

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02386 TrkH Cation transport protein 3.2E-139 417 806

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28584|TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK2 PE=1 SV=1 3 802 2.0E-173
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 25 813 3.0E-161
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 419 802 7.0E-141
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 36 822 2.0E-136
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 419 802 4.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28584|TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK2 PE=1 SV=1 3 802 2.0E-173
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 25 813 3.0E-161
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 419 802 7.0E-141
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 36 822 2.0E-136
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 419 802 4.0E-136
sp|Q54DA4|Y2412_DICDI Putative potassium transport protein DDB_G0292412 OS=Dictyostelium discoideum GN=DDB_G0292412 PE=2 SV=1 435 797 4.0E-35
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 28 212 4.0E-20
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 28 118 5.0E-20
sp|Q84TI7|HKT1_ARATH Sodium transporter HKT1 OS=Arabidopsis thaliana GN=HKT1 PE=1 SV=1 438 803 5.0E-20
sp|Q6H501|HKT6_ORYSJ Probable cation transporter HKT6 OS=Oryza sativa subsp. japonica GN=HKT6 PE=2 SV=1 438 757 2.0E-16
sp|Q0D9S3|HKT1_ORYSJ Cation transporter HKT1 OS=Oryza sativa subsp. japonica GN=HKT1 PE=1 SV=1 462 792 2.0E-14
sp|A2YGP9|HKT1_ORYSI Cation transporter HKT1 OS=Oryza sativa subsp. indica GN=HKT1 PE=1 SV=2 462 792 2.0E-14
sp|Q7XPF8|HKT4_ORYSJ Cation transporter HKT4 OS=Oryza sativa subsp. japonica GN=HKT4 PE=1 SV=2 486 787 2.0E-13
sp|Q93XI5|HKT2_ORYSI Cation transporter HKT2 OS=Oryza sativa subsp. indica GN=HKT2 PE=1 SV=1 462 792 2.0E-12
sp|Q8L481|HKT3_ORYSJ Probable cation transporter HKT3 OS=Oryza sativa subsp. japonica GN=HKT3 PE=2 SV=1 446 757 6.0E-12
sp|Q8L4K5|HKT9_ORYSJ Probable cation transporter HKT9 OS=Oryza sativa subsp. japonica GN=HKT9 PE=2 SV=1 458 785 8.0E-12
sp|Q7XPF7|HKT7_ORYSJ Probable cation transporter HKT7 OS=Oryza sativa subsp. japonica GN=HKT7 PE=2 SV=2 495 787 1.0E-09
sp|A2WNZ9|HKT8_ORYSI Cation transporter HKT8 OS=Oryza sativa subsp. indica GN=HKT8 PE=2 SV=2 491 787 5.0E-06
sp|Q0JNB6|HKT8_ORYSJ Cation transporter HKT8 OS=Oryza sativa subsp. japonica GN=HKT8 PE=3 SV=1 491 787 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008324 cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22
2 87 109 22
3 456 478 22
4 528 550 22
5 585 607 22
6 648 670 22
7 739 761 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4153
MLERARDYVWAQLKAVKPAFFSKKPHFSFITAHYFWIIGATIVSSIAIYASGHGKLAYVDALMFASGANTQAGLN
PVDVNLLNGFQQAMIYLFAILSNPITLHACVVFLRLYWFEKRFQSWVREIRSRRPTLTKSKSKARPDVEQAVPAQ
GVSGRNIRIVPHNGRSQRITNDGILLDDAQEGADGVAGVAKSEESDSTTMTDEKHSATEAGSPEPPSQDAHDSHD
GRAAQDARDSHAGHTAISFADTVKRSDGMGEDALKIPQRRPNAEHIAILERQRNQDNEVLRIPGPRDAERGLGPR
RLQIDESQDDDENMLARSRTVESRADHVAADSGNFRGRQPTITIAEPRRRRKDELADDARAAGSALGSLRFRRPR
LLNSRQKRYHEDGGEPRGNHPVGTRTLSSIRSALSRDREEDMPYLSYTPTLGRNSNFVGLTLEQREELGGIEYRS
LRTLALILLFYFWGFQLVILICLLPFILHNGYYGKVVEDAGISRTWWGFFTSNVAFMDVGFTLTPDSMISFQRSE
FALMIMWFFIIIGNTGFPVMLRFLIWMTAKIVPRGSGLWEELRFLLDHPRRCFTLLFPSGPSWWLFWILIVLNAL
DLLFFIVLDLGTEPIVQLPLRNRVVIGFFQAASTRTAGFSAVNMSDLHPAMPVLYMIMMYISVFPIAISIRRTNV
YEEQSLGVYQERTTDDDADASALSYVGSHLRRQLSFDLWYVFLGFFILAISEGDKIRAHKFDMFAVLFEVVSAYG
TVGLSMGAAGINASLSSQFTVVGKLVIIAMQIRGRHRGLPYGLDRAVLLPSESRFRKEAEEAEAVLARVNTGVSG
AAGTGLQRQRTNPVSVRSRSRERDRGNNSNLISQFLHPGPVVHRDTAVSHQRNRSIDSYAASLGPRTHTEPVSEA
GFDELAPIPSADSSHKPKRSETSAF*
Coding >Hirsu2|4153
ATGCTGGAGCGGGCCCGCGACTATGTTTGGGCGCAGCTCAAGGCTGTCAAGCCTGCTTTCTTCTCCAAGAAACCA
CACTTCAGCTTCATTACAGCGCACTACTTTTGGATCATCGGTGCGACCATCGTCTCGTCCATCGCCATCTACGCC
TCCGGTCACGGCAAACTGGCCTACGTCGACGCCTTGATGTTCGCCAGCGGCGCCAACACGCAAGCCGGCCTCAAC
CCGGTTGACGTGAACCTGCTCAATGGCTTTCAGCAGGCCATGATCTACCTCTTTGCCATATTGTCGAATCCCATC
ACCCTCCACGCCTGCGTCGTTTTCCTCAGGCTCTACTGGTTCGAGAAGCGGTTTCAGAGCTGGGTTCGCGAGATC
CGCTCCCGCCGGCCGACCCTGACCAAGTCAAAGTCCAAAGCCCGCCCCGACGTGGAACAGGCGGTGCCTGCGCAG
GGCGTCAGTGGGCGGAACATTAGAATTGTCCCGCACAACGGCCGCAGCCAGAGGATCACAAACGACGGCATCCTG
CTGGACGACGCGCAGGAGGGTGCCGACGGGGTGGCCGGCGTGGCCAAGAGCGAAGAGAGCGACTCGACCACGATG
ACCGATGAGAAGCACAGCGCCACCGAGGCGGGCTCGCCAGAGCCCCCCAGCCAGGATGCCCACGACTCGCACGAC
GGCCGGGCAGCCCAGGACGCCAGAGACAGCCACGCCGGCCACACGGCAATCTCGTTCGCCGACACGGTCAAGCGA
AGCGACGGCATGGGGGAGGATGCTCTGAAAATCCCCCAGCGCCGGCCCAACGCCGAACACATCGCCATCCTGGAA
CGGCAGAGGAACCAGGACAATGAGGTCCTGCGGATCCCGGGGCCGAGGGACGCGGAGAGAGGCCTGGGGCCCAGG
AGGCTCCAGATCGACGAGTCCCAGGATGATGATGAGAACATGCTCGCCAGGTCCAGGACGGTGGAGTCGCGGGCC
GATCATGTCGCGGCCGACTCCGGCAACTTTCGCGGCCGCCAGCCCACCATAACCATCGCGGAGCCCCGGCGGCGC
CGCAAGGACGAGCTCGCAGACGATGCCAGGGCGGCCGGCAGCGCCCTGGGCTCGCTCCGTTTCCGGAGGCCCCGT
CTGCTCAACTCGAGGCAGAAGAGATACCACGAGGACGGCGGCGAGCCGCGGGGCAACCACCCCGTCGGGACGCGA
ACCTTGAGCTCCATTCGATCCGCCCTGTCCCGGGACAGGGAGGAGGACATGCCCTACCTGTCGTACACGCCGACG
CTGGGCCGGAATTCAAACTTCGTCGGCCTGACGCTCGAGCAGCGCGAGGAGCTCGGCGGCATCGAGTACCGCTCC
CTCCGGACGCTGGCCCTCATCCTGCTGTTCTATTTTTGGGGCTTTCAGCTCGTCATCCTCATCTGCCTCCTGCCC
TTTATCCTCCACAACGGATACTACGGTAAAGTCGTCGAGGACGCCGGCATCTCGAGGACCTGGTGGGGCTTCTTC
ACCTCCAACGTGGCATTCATGGACGTGGGCTTCACCCTCACGCCCGACAGCATGATCTCCTTCCAGAGATCCGAG
TTCGCCCTGATGATCATGTGGTTCTTCATCATCATCGGCAACACGGGCTTCCCGGTCATGCTGCGCTTTCTCATC
TGGATGACGGCCAAGATCGTGCCGCGGGGCTCCGGCCTGTGGGAGGAGCTGCGCTTCCTGCTGGACCACCCCCGT
AGATGTTTCACCCTGCTGTTCCCGTCCGGCCCAAGCTGGTGGCTGTTTTGGATCCTGATTGTGCTCAACGCCCTC
GACCTGCTTTTTTTTATTGTCCTCGACCTCGGCACGGAACCCATCGTCCAGCTTCCGCTCAGGAACCGGGTGGTC
ATCGGCTTCTTCCAGGCTGCATCCACCCGGACGGCTGGCTTCTCGGCCGTCAACATGTCGGACCTGCATCCGGCC
ATGCCGGTGCTGTACATGATCATGATGTACATTTCCGTCTTCCCCATTGCCATATCGATCCGGCGGACCAACGTC
TACGAGGAACAGTCACTCGGCGTCTACCAGGAGCGGACGACGGACGACGACGCCGACGCCAGCGCCCTGTCGTAT
GTCGGGAGCCACTTGAGGCGGCAGCTGTCGTTTGACTTGTGGTACGTCTTCTTGGGCTTCTTCATCCTCGCCATC
AGCGAGGGAGACAAGATTCGAGCCCACAAGTTCGACATGTTCGCCGTCCTCTTCGAGGTGGTGAGCGCCTACGGG
ACGGTGGGCCTGAGCATGGGGGCGGCCGGCATCAACGCCTCGCTGTCGTCGCAGTTCACCGTCGTCGGCAAGCTG
GTCATCATCGCCATGCAGATCCGCGGCCGGCACCGCGGCCTGCCCTACGGCCTGGACCGCGCCGTGCTGCTGCCC
AGCGAGTCTCGGTTCCGCAAGGAGGCCGAGGAGGCCGAGGCCGTCCTGGCGCGCGTCAACACTGGCGTCTCGGGC
GCGGCGGGGACGGGGCTGCAGCGGCAGAGGACCAACCCCGTCAGCGTCCGCAGCAGGAGCCGCGAGCGGGACCGG
GGCAACAACAGCAACCTCATTTCTCAGTTTCTCCACCCGGGCCCCGTCGTGCATCGCGACACGGCGGTGTCCCAT
CAGAGGAACCGGTCGATTGATTCGTATGCCGCGTCGCTGGGCCCGAGGACGCACACGGAGCCCGTCAGCGAAGCC
GGCTTCGACGAGCTGGCTCCGATACCCAGCGCAGATTCATCGCACAAGCCGAAGAGGTCCGAGACGTCGGCGTTC
TAG
Transcript >Hirsu2|4153
ATGCTGGAGCGGGCCCGCGACTATGTTTGGGCGCAGCTCAAGGCTGTCAAGCCTGCTTTCTTCTCCAAGAAACCA
CACTTCAGCTTCATTACAGCGCACTACTTTTGGATCATCGGTGCGACCATCGTCTCGTCCATCGCCATCTACGCC
TCCGGTCACGGCAAACTGGCCTACGTCGACGCCTTGATGTTCGCCAGCGGCGCCAACACGCAAGCCGGCCTCAAC
CCGGTTGACGTGAACCTGCTCAATGGCTTTCAGCAGGCCATGATCTACCTCTTTGCCATATTGTCGAATCCCATC
ACCCTCCACGCCTGCGTCGTTTTCCTCAGGCTCTACTGGTTCGAGAAGCGGTTTCAGAGCTGGGTTCGCGAGATC
CGCTCCCGCCGGCCGACCCTGACCAAGTCAAAGTCCAAAGCCCGCCCCGACGTGGAACAGGCGGTGCCTGCGCAG
GGCGTCAGTGGGCGGAACATTAGAATTGTCCCGCACAACGGCCGCAGCCAGAGGATCACAAACGACGGCATCCTG
CTGGACGACGCGCAGGAGGGTGCCGACGGGGTGGCCGGCGTGGCCAAGAGCGAAGAGAGCGACTCGACCACGATG
ACCGATGAGAAGCACAGCGCCACCGAGGCGGGCTCGCCAGAGCCCCCCAGCCAGGATGCCCACGACTCGCACGAC
GGCCGGGCAGCCCAGGACGCCAGAGACAGCCACGCCGGCCACACGGCAATCTCGTTCGCCGACACGGTCAAGCGA
AGCGACGGCATGGGGGAGGATGCTCTGAAAATCCCCCAGCGCCGGCCCAACGCCGAACACATCGCCATCCTGGAA
CGGCAGAGGAACCAGGACAATGAGGTCCTGCGGATCCCGGGGCCGAGGGACGCGGAGAGAGGCCTGGGGCCCAGG
AGGCTCCAGATCGACGAGTCCCAGGATGATGATGAGAACATGCTCGCCAGGTCCAGGACGGTGGAGTCGCGGGCC
GATCATGTCGCGGCCGACTCCGGCAACTTTCGCGGCCGCCAGCCCACCATAACCATCGCGGAGCCCCGGCGGCGC
CGCAAGGACGAGCTCGCAGACGATGCCAGGGCGGCCGGCAGCGCCCTGGGCTCGCTCCGTTTCCGGAGGCCCCGT
CTGCTCAACTCGAGGCAGAAGAGATACCACGAGGACGGCGGCGAGCCGCGGGGCAACCACCCCGTCGGGACGCGA
ACCTTGAGCTCCATTCGATCCGCCCTGTCCCGGGACAGGGAGGAGGACATGCCCTACCTGTCGTACACGCCGACG
CTGGGCCGGAATTCAAACTTCGTCGGCCTGACGCTCGAGCAGCGCGAGGAGCTCGGCGGCATCGAGTACCGCTCC
CTCCGGACGCTGGCCCTCATCCTGCTGTTCTATTTTTGGGGCTTTCAGCTCGTCATCCTCATCTGCCTCCTGCCC
TTTATCCTCCACAACGGATACTACGGTAAAGTCGTCGAGGACGCCGGCATCTCGAGGACCTGGTGGGGCTTCTTC
ACCTCCAACGTGGCATTCATGGACGTGGGCTTCACCCTCACGCCCGACAGCATGATCTCCTTCCAGAGATCCGAG
TTCGCCCTGATGATCATGTGGTTCTTCATCATCATCGGCAACACGGGCTTCCCGGTCATGCTGCGCTTTCTCATC
TGGATGACGGCCAAGATCGTGCCGCGGGGCTCCGGCCTGTGGGAGGAGCTGCGCTTCCTGCTGGACCACCCCCGT
AGATGTTTCACCCTGCTGTTCCCGTCCGGCCCAAGCTGGTGGCTGTTTTGGATCCTGATTGTGCTCAACGCCCTC
GACCTGCTTTTTTTTATTGTCCTCGACCTCGGCACGGAACCCATCGTCCAGCTTCCGCTCAGGAACCGGGTGGTC
ATCGGCTTCTTCCAGGCTGCATCCACCCGGACGGCTGGCTTCTCGGCCGTCAACATGTCGGACCTGCATCCGGCC
ATGCCGGTGCTGTACATGATCATGATGTACATTTCCGTCTTCCCCATTGCCATATCGATCCGGCGGACCAACGTC
TACGAGGAACAGTCACTCGGCGTCTACCAGGAGCGGACGACGGACGACGACGCCGACGCCAGCGCCCTGTCGTAT
GTCGGGAGCCACTTGAGGCGGCAGCTGTCGTTTGACTTGTGGTACGTCTTCTTGGGCTTCTTCATCCTCGCCATC
AGCGAGGGAGACAAGATTCGAGCCCACAAGTTCGACATGTTCGCCGTCCTCTTCGAGGTGGTGAGCGCCTACGGG
ACGGTGGGCCTGAGCATGGGGGCGGCCGGCATCAACGCCTCGCTGTCGTCGCAGTTCACCGTCGTCGGCAAGCTG
GTCATCATCGCCATGCAGATCCGCGGCCGGCACCGCGGCCTGCCCTACGGCCTGGACCGCGCCGTGCTGCTGCCC
AGCGAGTCTCGGTTCCGCAAGGAGGCCGAGGAGGCCGAGGCCGTCCTGGCGCGCGTCAACACTGGCGTCTCGGGC
GCGGCGGGGACGGGGCTGCAGCGGCAGAGGACCAACCCCGTCAGCGTCCGCAGCAGGAGCCGCGAGCGGGACCGG
GGCAACAACAGCAACCTCATTTCTCAGTTTCTCCACCCGGGCCCCGTCGTGCATCGCGACACGGCGGTGTCCCAT
CAGAGGAACCGGTCGATTGATTCGTATGCCGCGTCGCTGGGCCCGAGGACGCACACGGAGCCCGTCAGCGAAGCC
GGCTTCGACGAGCTGGCTCCGATACCCAGCGCAGATTCATCGCACAAGCCGAAGAGGTCCGAGACGTCGGCGTTC
TAG
Gene >Hirsu2|4153
ATGCTGGAGCGGGCCCGCGACTATGTTTGGGCGCAGCTCAAGGCTGTCAAGCCTGCTTTCTTCTCCAAGAAACCA
CACTTCAGCTTCATTACAGCGCACTGTCGGTCAAGCCCCTTCCCCGGCATCGCCCTTTGCTAACGTGGGCTTGCG
CAGACTTTTGGATCATCGGTGCGACCATCGTCTCGTCCATCGCCATCTACGCCTCCGGTCACGGCAAACTGGCCT
ACGTCGACGCCTTGATGTTCGCCAGCGGCGCCAACACGCAAGCCGGCCTCAACCCGGTTGACGTGAACCTGCTCA
ATGGCTTTCAGCAGGCCATGATCTACCTCTTTGCCATATTGTCGAATCCCATCACCCTCCACGCCTGCGTCGTTT
TCCTCAGGCTCTACTGGTTCGAGAAGCGGTTTCAGAGCTGGGTTCGCGAGATCCGCTCCCGCCGGCCGACCCTGA
CCAAGTCAAAGTCCAAAGCCCGCCCCGACGTGGAACAGGCGGTGCCTGCGCAGGGCGTCAGTGGGCGGAACATTA
GAATTGTCCCGCACAACGGCCGCAGCCAGAGGATCACAAACGACGGCATCCTGCTGGACGACGCGCAGGAGGGTG
CCGACGGGGTGGCCGGCGTGGCCAAGAGCGAAGAGAGCGACTCGACCACGATGACCGATGAGAAGCACAGCGCCA
CCGAGGCGGGCTCGCCAGAGCCCCCCAGCCAGGATGCCCACGACTCGCACGACGGCCGGGCAGCCCAGGACGCCA
GAGACAGCCACGCCGGCCACACGGCAATCTCGTTCGCCGACACGGTCAAGCGAAGCGACGGCATGGGGGAGGATG
CTCTGAAAATCCCCCAGCGCCGGCCCAACGCCGAACACATCGCCATCCTGGAACGGCAGAGGAACCAGGACAATG
AGGTCCTGCGGATCCCGGGGCCGAGGGACGCGGAGAGAGGCCTGGGGCCCAGGAGGCTCCAGATCGACGAGTCCC
AGGATGATGATGAGAACATGCTCGCCAGGTCCAGGACGGTGGAGTCGCGGGCCGATCATGTCGCGGCCGACTCCG
GCAACTTTCGCGGCCGCCAGCCCACCATAACCATCGCGGAGCCCCGGCGGCGCCGCAAGGACGAGCTCGCAGACG
ATGCCAGGGCGGCCGGCAGCGCCCTGGGCTCGCTCCGTTTCCGGAGGCCCCGTCTGCTCAACTCGAGGCAGAAGA
GATACCACGAGGACGGCGGCGAGCCGCGGGGCAACCACCCCGTCGGGACGCGAACCTTGAGCTCCATTCGATCCG
CCCTGTCCCGGGACAGGGAGGAGGACATGCCCTACCTGTCGTACACGCCGACGCTGGGCCGGAATTCAAACTTCG
TCGGCCTGACGCTCGAGCAGCGCGAGGAGCTCGGCGGCATCGAGTACCGCTCCCTCCGGACGCTGGCCCTCATCC
TGCTGTTCTATTTTTGGGGCTTTCAGCTCGTCATCCTCATCTGCCTCCTGCCCTTTATCCTCCACAACGGATACT
ACGGTAAAGTCGTCGAGGACGCCGGCATCTCGAGGACCTGGTGGGGCTTCTTCACCTCCAACGTGGCATTCATGG
ACGTGGGCTTCACCCTCACGCCCGACAGCATGATCTCCTTCCAGAGATCCGAGTTCGCCCTGATGATCATGTGGT
TCTTCATCATCATCGGCAACACGGGCTTCCCGGTCATGCTGCGCTTTCTCATCTGGATGACGGCCAAGATCGTGC
CGCGGGGCTCCGGCCTGTGGGAGGAGCTGCGCTTCCTGCTGGACCACCCCCGTAGATGTTTCACCCTGCTGTTCC
CGTCCGGCCCAAGCTGGTGGCTGTTTTGGATCCTGATTGTGCTCAACGCCCTCGACCTGCTTTTTTTTATTGTCC
TCGACGTAAGTCTCAGGCCCCCTCCCCCCTTCTTCCGAACCCCTGGCCCTGCAGCACCCGAGCAAGAGCGCTAAT
TGGCTTGTCTCACTCGCGCAGCTCGGCACGGAACCCATCGTCCAGCTTCCGCTCAGGAACCGGGTGGTCATCGGC
TTCTTCCAGGCTGCATCCACCCGGACGGCTGGCTTCTCGGCCGTCAACATGTCGGACCTGCATCCGGCCATGCCG
GTGCTGTACATGATCATGATGTACATTTCCGTCTTCCCCATTGCCATATCGATCCGGCGGACCAACGTCTACGAG
GAACAGTCACTCGGCGTCTACCAGGAGCGGACGACGGACGACGACGCCGACGCCAGCGCCCTGTCGTATGTCGGG
AGCCACTTGAGGCGGCAGCTGTCGTTTGACTTGTGGTACGTCTTCTTGGGCTTCTTCATCCTCGCCATCAGCGAG
GGAGACAAGATTCGAGCCCACAAGTTCGACATGTTCGCCGTCCTCTTCGAGGTGGTGAGCGCCTACGGGACGGTG
GGCCTGAGCATGGGGGCGGCCGGCATCAACGCCTCGCTGTCGTCGCAGTTCACCGTCGTCGGCAAGCTGGTCATC
ATCGCCATGCAGATCCGCGGCCGGCACCGCGGCCTGCCCTACGGCCTGGACCGCGCCGTGCTGCTGCCCAGCGAG
TCTCGGTTCCGCAAGGAGGCCGAGGAGGCCGAGGCCGTCCTGGCGCGCGTCAACACTGGCGTCTCGGGCGCGGCG
GGGACGGGGCTGCAGCGGCAGAGGACCAACCCCGTCAGCGTCCGCAGCAGGAGCCGCGAGCGGGACCGGGGCAAC
AACAGCAACCTCATTTCTCAGTTTCTCCACCCGGGCCCCGTCGTGCATCGCGACACGGCGGTGTCCCATCAGAGG
AACCGGTCGATTGATTCGTATGCCGCGTCGCTGGGCCCGAGGACGCACACGGAGCCCGTCAGCGAAGCCGGCTTC
GACGAGCTGGCTCCGATACCCAGCGCAGATTCATCGCACAAGCCGAAGAGGTCCGAGACGTCGGCGTTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail