Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4152
Gene name
LocationContig_214:18506..21002
Strand+
Gene length (bp)2496
Transcript length (bp)2496
Coding sequence length (bp)2496
Protein length (aa) 832

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16203 ERCC3_RAD25_C ERCC3/RAD25/XPB C-terminal helicase 2.0E-122 525 760
PF13625 Helicase_C_3 Helicase conserved C-terminal domain 3.5E-33 103 227
PF04851 ResIII Type III restriction enzyme, res subunit 1.1E-14 342 499
PF00271 Helicase_C Helicase conserved C-terminal domain 1.1E-11 569 675
PF00176 SNF2_N SNF2 family N-terminal domain 4.1E-07 368 502

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00578|RAD25_YEAST DNA repair helicase RAD25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSL2 PE=1 SV=1 82 807 0.0E+00
sp|A9CRJ7|RAD25_ENTBH Probable DNA repair helicase RAD25 homolog OS=Enterocytozoon bieneusi (strain H348) GN=RAD25 PE=3 SV=1 297 756 0.0E+00
sp|Q6E6J3|RAD25_ANTLO Probable DNA repair helicase RAD25 homolog OS=Antonospora locustae GN=RAD25 PE=3 SV=1 290 747 0.0E+00
sp|C4V922|RAD25_NOSCE Probable DNA repair helicase RAD25 homolog OS=Nosema ceranae (strain BRL01) GN=RAD25 PE=3 SV=1 303 800 0.0E+00
sp|Q8SSK1|RAD25_ENCCU Probable DNA repair helicase RAD25 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RAD25 PE=3 SV=2 91 811 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00578|RAD25_YEAST DNA repair helicase RAD25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSL2 PE=1 SV=1 82 807 0.0E+00
sp|A9CRJ7|RAD25_ENTBH Probable DNA repair helicase RAD25 homolog OS=Enterocytozoon bieneusi (strain H348) GN=RAD25 PE=3 SV=1 297 756 0.0E+00
sp|Q6E6J3|RAD25_ANTLO Probable DNA repair helicase RAD25 homolog OS=Antonospora locustae GN=RAD25 PE=3 SV=1 290 747 0.0E+00
sp|C4V922|RAD25_NOSCE Probable DNA repair helicase RAD25 homolog OS=Nosema ceranae (strain BRL01) GN=RAD25 PE=3 SV=1 303 800 0.0E+00
sp|Q8SSK1|RAD25_ENCCU Probable DNA repair helicase RAD25 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RAD25 PE=3 SV=2 91 811 0.0E+00
sp|Q9FUG4|XPB2_ARATH DNA repair helicase XPB2 OS=Arabidopsis thaliana GN=XPB2 PE=2 SV=1 86 820 0.0E+00
sp|Q38861|XPB1_ARATH DNA repair helicase XPB1 OS=Arabidopsis thaliana GN=XPB1 PE=2 SV=3 86 820 0.0E+00
sp|Q5ZKK7|ERCC3_CHICK TFIIH basal transcription factor complex helicase XPB subunit OS=Gallus gallus GN=ERCC3 PE=2 SV=1 83 804 0.0E+00
sp|Q02870|ERCC3_DROME DNA excision repair protein haywire OS=Drosophila melanogaster GN=hay PE=1 SV=2 83 800 0.0E+00
sp|Q7ZVV1|ERCC3_DANRE TFIIH basal transcription factor complex helicase XPB subunit OS=Danio rerio GN=ercc3 PE=2 SV=1 83 796 0.0E+00
sp|Q5RA62|ERCC3_PONAB TFIIH basal transcription factor complex helicase XPB subunit OS=Pongo abelii GN=ERCC3 PE=2 SV=1 83 807 0.0E+00
sp|P19447|ERCC3_HUMAN TFIIH basal transcription factor complex helicase XPB subunit OS=Homo sapiens GN=ERCC3 PE=1 SV=1 83 807 0.0E+00
sp|Q1RMT1|ERCC3_BOVIN TFIIH basal transcription factor complex helicase XPB subunit OS=Bos taurus GN=ERCC3 PE=2 SV=1 83 796 0.0E+00
sp|Q60HG1|ERCC3_MACFA TFIIH basal transcription factor complex helicase XPB subunit OS=Macaca fascicularis GN=ERCC3 PE=2 SV=1 83 807 0.0E+00
sp|P49135|ERCC3_MOUSE TFIIH basal transcription factor complex helicase XPB subunit OS=Mus musculus GN=Ercc3 PE=2 SV=1 83 807 0.0E+00
sp|Q4G005|ERCC3_RAT TFIIH basal transcription factor complex helicase XPB subunit OS=Rattus norvegicus GN=Ercc3 PE=1 SV=1 83 807 0.0E+00
sp|O00835|ERCC3_DICDI TFIIH basal transcription factor complex helicase repB subunit OS=Dictyostelium discoideum GN=repB PE=2 SV=1 93 796 0.0E+00
sp|O13768|ERCC3_SCHPO Probable DNA repair helicase ercc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ercc3 PE=1 SV=1 82 820 0.0E+00
sp|Q9HPZ2|RAD25_HALSA Putative DNA helicase Rad25 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rad25 PE=3 SV=2 299 712 2.0E-40
sp|Q5V5F7|RAD25_HALMA Putative DNA helicase Rad25 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rad25 PE=3 SV=2 307 712 1.0E-36
sp|C4V922|RAD25_NOSCE Probable DNA repair helicase RAD25 homolog OS=Nosema ceranae (strain BRL01) GN=RAD25 PE=3 SV=1 93 221 1.0E-32
sp|Q6E6J3|RAD25_ANTLO Probable DNA repair helicase RAD25 homolog OS=Antonospora locustae GN=RAD25 PE=3 SV=1 91 229 5.0E-31
sp|A9CRJ7|RAD25_ENTBH Probable DNA repair helicase RAD25 homolog OS=Enterocytozoon bieneusi (strain H348) GN=RAD25 PE=3 SV=1 93 229 5.0E-26
sp|Q914K8|Y022_SIFVH Putative helicase 22 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0022 PE=3 SV=1 334 683 1.0E-09
sp|Q5UQ46|YL396_MIMIV Putative ATP-dependent RNA helicase L396 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L396 PE=3 SV=1 336 615 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4152
MPPKRKAVPAVQGAAKAGRTSRVSTPGAATPRSLESNEPEPEEEDEAPVDEVLERDIDKNIDRFSLDKYQKKHSI
REPLPHIFGDRDFSYLELKKDHRNRPLWIDPQKGRIILESFNPLAEQAQDFLITISEPLSRPTFMHEYALTTHSL
YAAVSVGLSPDDIINTLERFLKTPLPDEIREFITSCTQSYGKVKLVLKNTKYYVESPDPNMLQTLLKNPKIGPLR
VQGTEEITTSAAPKIGGLVIPGTKNAAGVKQANGLQQPGSEQPKDGQPAQAGDVLADLNEEDDEDQEVTHSFEIA
DKDVETVQKECLNLGYPVLEEYDFRRDEVNPNLDIDLKPGTQIRPYQEKSLSKMFGNGRAKSGLIVLPCGAGKTL
VGITAACTIKKGVIVLCTSSMSVVQWRNEFLKWSNINPDDIVAFTSDSKGSVFTGSTGIIVTTYSMVTQSRARSY
DAEKMMRFLTGREWGLMLLDEVHVVPANIFRKVTSSIKTHSKLGLTATLLREDDKISDLNFLIGPKLFEANWMEL
SKQGHIARVQCAEVWCPMPTEFYDEYLRAPSRKKNLLYIMNPRKFQACQYLINYHESRGDKIIVFSDNVYALKAY
ALKLGKAFIYGSTGQAERLQVLENFQHNPHVNTLFLSKIGDTSLDLPEATCLIQISSHYGSRRQEAQRLGRILRA
KRRNDEGFNAFFYSLVSKDTQEMYFSSKRQAFLVDQGYAFKVITHLANIEKTPGLAFATASERRELLQKVLVEND
TMEDEDITDDLFHSGSMGRKKKRGAARRTAGTLGELSGGQDMAYIEQNKRMNQALKKGKGKKESSSFFKKIGREN
ARRAAQ*
Coding >Hirsu2|4152
ATGCCGCCGAAGCGGAAGGCTGTGCCAGCCGTACAGGGAGCGGCCAAGGCCGGCAGGACGTCGCGGGTGTCGACG
CCCGGAGCTGCGACGCCTCGAAGCCTCGAGAGCAACGAGCCGGAGCCGGAAGAGGAAGATGAAGCGCCGGTGGAC
GAGGTGCTCGAGCGGGACATCGACAAGAACATAGACCGATTCTCTCTTGATAAATACCAGAAGAAGCACTCCATT
CGGGAGCCGCTCCCGCACATCTTCGGCGACCGTGACTTTTCGTATCTCGAGCTGAAGAAAGACCACCGCAACCGG
CCGCTCTGGATCGACCCGCAGAAGGGGAGGATCATCCTCGAGAGCTTCAACCCGCTGGCCGAGCAAGCCCAAGAC
TTCCTCATCACCATCTCGGAGCCGCTGTCCCGGCCGACGTTTATGCACGAGTATGCCCTCACGACGCACAGCCTC
TACGCCGCCGTCTCCGTCGGCCTCTCGCCCGACGACATCATCAATACCCTCGAGCGCTTCCTCAAGACGCCGCTC
CCGGACGAGATCCGAGAGTTTATCACGAGCTGCACCCAGAGCTACGGCAAGGTCAAGCTGGTCCTGAAGAATACC
AAGTACTACGTCGAGTCTCCGGATCCGAACATGCTGCAGACGCTGCTCAAGAACCCCAAAATCGGGCCTCTGAGG
GTGCAAGGGACGGAAGAGATCACGACGTCTGCCGCCCCCAAGATCGGCGGCCTCGTCATTCCAGGCACGAAGAAC
GCGGCCGGGGTCAAGCAGGCAAACGGTCTGCAACAGCCCGGCTCGGAGCAGCCCAAGGACGGCCAGCCGGCCCAG
GCGGGAGACGTGCTTGCCGACTTGAACGAGGAGGACGACGAGGACCAGGAAGTGACGCACTCGTTCGAAATCGCC
GACAAGGATGTCGAGACGGTGCAGAAGGAGTGTCTGAACCTCGGCTATCCCGTGCTCGAGGAATACGACTTCCGC
AGGGACGAGGTCAACCCCAACCTCGACATCGACCTCAAGCCCGGCACGCAGATCCGTCCGTACCAGGAGAAGAGC
CTGAGCAAGATGTTCGGCAACGGCCGAGCCAAGAGCGGGCTGATCGTCCTGCCCTGCGGCGCCGGCAAGACGCTC
GTCGGCATCACGGCCGCCTGCACCATCAAAAAGGGCGTCATCGTGCTGTGCACCAGCTCCATGTCGGTGGTGCAG
TGGCGCAACGAGTTTCTGAAGTGGTCCAACATCAACCCGGACGACATCGTGGCCTTTACGTCGGACTCGAAGGGG
TCGGTGTTTACGGGAAGCACGGGCATCATCGTGACGACGTACTCGATGGTGACGCAGTCTCGGGCGCGGTCGTAC
GACGCGGAGAAGATGATGCGGTTCCTGACGGGGCGAGAATGGGGTCTCATGCTGCTGGACGAGGTGCACGTCGTG
CCGGCCAACATCTTCCGCAAGGTGACGTCGTCGATCAAGACGCACTCGAAGCTGGGGCTCACGGCCACGCTGCTC
CGGGAAGACGACAAGATCTCGGACCTCAACTTCCTCATCGGGCCGAAGCTGTTCGAGGCCAACTGGATGGAGCTG
TCGAAGCAGGGCCACATCGCGCGCGTGCAGTGCGCCGAAGTGTGGTGCCCGATGCCGACCGAGTTTTACGACGAG
TACCTGCGGGCGCCGTCGCGCAAGAAGAACCTGCTGTACATTATGAACCCGCGCAAGTTTCAGGCGTGCCAGTAC
CTCATCAACTACCACGAGTCCCGGGGGGACAAGATCATCGTCTTCTCGGACAACGTGTACGCGCTCAAGGCGTAC
GCGCTCAAGCTGGGCAAGGCCTTCATCTACGGCAGCACGGGACAGGCGGAGCGGCTGCAGGTGCTGGAGAACTTC
CAGCACAACCCGCACGTCAACACGCTGTTCCTGTCCAAGATCGGCGACACGTCGCTGGACCTGCCCGAGGCTACG
TGCCTCATCCAGATCTCGTCGCACTACGGCTCGCGCCGTCAGGAGGCGCAGAGACTGGGGCGGATCCTGCGAGCC
AAGCGCAGAAACGACGAGGGCTTCAACGCCTTCTTCTACTCGCTCGTCTCCAAGGACACGCAGGAGATGTACTTT
TCGTCGAAGCGGCAGGCCTTCCTGGTGGACCAGGGGTACGCCTTCAAGGTGATTACGCACCTGGCCAACATCGAG
AAGACGCCGGGGCTCGCGTTCGCGACGGCGAGCGAGCGGCGGGAGCTGCTGCAGAAGGTGCTGGTGGAGAACGAC
ACGATGGAGGACGAGGACATCACGGACGACCTCTTCCACAGCGGCAGCATGGGCCGCAAGAAGAAGAGGGGCGCG
GCGCGGCGGACGGCGGGGACGCTGGGGGAGCTCAGCGGCGGGCAGGACATGGCGTACATTGAGCAGAACAAGAGG
ATGAACCAGGCGCTGAAGAAGGGCAAGGGCAAGAAGGAGAGCAGCTCGTTCTTCAAGAAGATTGGGCGCGAGAAC
GCCCGACGGGCGGCGCAATAG
Transcript >Hirsu2|4152
ATGCCGCCGAAGCGGAAGGCTGTGCCAGCCGTACAGGGAGCGGCCAAGGCCGGCAGGACGTCGCGGGTGTCGACG
CCCGGAGCTGCGACGCCTCGAAGCCTCGAGAGCAACGAGCCGGAGCCGGAAGAGGAAGATGAAGCGCCGGTGGAC
GAGGTGCTCGAGCGGGACATCGACAAGAACATAGACCGATTCTCTCTTGATAAATACCAGAAGAAGCACTCCATT
CGGGAGCCGCTCCCGCACATCTTCGGCGACCGTGACTTTTCGTATCTCGAGCTGAAGAAAGACCACCGCAACCGG
CCGCTCTGGATCGACCCGCAGAAGGGGAGGATCATCCTCGAGAGCTTCAACCCGCTGGCCGAGCAAGCCCAAGAC
TTCCTCATCACCATCTCGGAGCCGCTGTCCCGGCCGACGTTTATGCACGAGTATGCCCTCACGACGCACAGCCTC
TACGCCGCCGTCTCCGTCGGCCTCTCGCCCGACGACATCATCAATACCCTCGAGCGCTTCCTCAAGACGCCGCTC
CCGGACGAGATCCGAGAGTTTATCACGAGCTGCACCCAGAGCTACGGCAAGGTCAAGCTGGTCCTGAAGAATACC
AAGTACTACGTCGAGTCTCCGGATCCGAACATGCTGCAGACGCTGCTCAAGAACCCCAAAATCGGGCCTCTGAGG
GTGCAAGGGACGGAAGAGATCACGACGTCTGCCGCCCCCAAGATCGGCGGCCTCGTCATTCCAGGCACGAAGAAC
GCGGCCGGGGTCAAGCAGGCAAACGGTCTGCAACAGCCCGGCTCGGAGCAGCCCAAGGACGGCCAGCCGGCCCAG
GCGGGAGACGTGCTTGCCGACTTGAACGAGGAGGACGACGAGGACCAGGAAGTGACGCACTCGTTCGAAATCGCC
GACAAGGATGTCGAGACGGTGCAGAAGGAGTGTCTGAACCTCGGCTATCCCGTGCTCGAGGAATACGACTTCCGC
AGGGACGAGGTCAACCCCAACCTCGACATCGACCTCAAGCCCGGCACGCAGATCCGTCCGTACCAGGAGAAGAGC
CTGAGCAAGATGTTCGGCAACGGCCGAGCCAAGAGCGGGCTGATCGTCCTGCCCTGCGGCGCCGGCAAGACGCTC
GTCGGCATCACGGCCGCCTGCACCATCAAAAAGGGCGTCATCGTGCTGTGCACCAGCTCCATGTCGGTGGTGCAG
TGGCGCAACGAGTTTCTGAAGTGGTCCAACATCAACCCGGACGACATCGTGGCCTTTACGTCGGACTCGAAGGGG
TCGGTGTTTACGGGAAGCACGGGCATCATCGTGACGACGTACTCGATGGTGACGCAGTCTCGGGCGCGGTCGTAC
GACGCGGAGAAGATGATGCGGTTCCTGACGGGGCGAGAATGGGGTCTCATGCTGCTGGACGAGGTGCACGTCGTG
CCGGCCAACATCTTCCGCAAGGTGACGTCGTCGATCAAGACGCACTCGAAGCTGGGGCTCACGGCCACGCTGCTC
CGGGAAGACGACAAGATCTCGGACCTCAACTTCCTCATCGGGCCGAAGCTGTTCGAGGCCAACTGGATGGAGCTG
TCGAAGCAGGGCCACATCGCGCGCGTGCAGTGCGCCGAAGTGTGGTGCCCGATGCCGACCGAGTTTTACGACGAG
TACCTGCGGGCGCCGTCGCGCAAGAAGAACCTGCTGTACATTATGAACCCGCGCAAGTTTCAGGCGTGCCAGTAC
CTCATCAACTACCACGAGTCCCGGGGGGACAAGATCATCGTCTTCTCGGACAACGTGTACGCGCTCAAGGCGTAC
GCGCTCAAGCTGGGCAAGGCCTTCATCTACGGCAGCACGGGACAGGCGGAGCGGCTGCAGGTGCTGGAGAACTTC
CAGCACAACCCGCACGTCAACACGCTGTTCCTGTCCAAGATCGGCGACACGTCGCTGGACCTGCCCGAGGCTACG
TGCCTCATCCAGATCTCGTCGCACTACGGCTCGCGCCGTCAGGAGGCGCAGAGACTGGGGCGGATCCTGCGAGCC
AAGCGCAGAAACGACGAGGGCTTCAACGCCTTCTTCTACTCGCTCGTCTCCAAGGACACGCAGGAGATGTACTTT
TCGTCGAAGCGGCAGGCCTTCCTGGTGGACCAGGGGTACGCCTTCAAGGTGATTACGCACCTGGCCAACATCGAG
AAGACGCCGGGGCTCGCGTTCGCGACGGCGAGCGAGCGGCGGGAGCTGCTGCAGAAGGTGCTGGTGGAGAACGAC
ACGATGGAGGACGAGGACATCACGGACGACCTCTTCCACAGCGGCAGCATGGGCCGCAAGAAGAAGAGGGGCGCG
GCGCGGCGGACGGCGGGGACGCTGGGGGAGCTCAGCGGCGGGCAGGACATGGCGTACATTGAGCAGAACAAGAGG
ATGAACCAGGCGCTGAAGAAGGGCAAGGGCAAGAAGGAGAGCAGCTCGTTCTTCAAGAAGATTGGGCGCGAGAAC
GCCCGACGGGCGGCGCAATAG
Gene >Hirsu2|4152
ATGCCGCCGAAGCGGAAGGCTGTGCCAGCCGTACAGGGAGCGGCCAAGGCCGGCAGGACGTCGCGGGTGTCGACG
CCCGGAGCTGCGACGCCTCGAAGCCTCGAGAGCAACGAGCCGGAGCCGGAAGAGGAAGATGAAGCGCCGGTGGAC
GAGGTGCTCGAGCGGGACATCGACAAGAACATAGACCGATTCTCTCTTGATAAATACCAGAAGAAGCACTCCATT
CGGGAGCCGCTCCCGCACATCTTCGGCGACCGTGACTTTTCGTATCTCGAGCTGAAGAAAGACCACCGCAACCGG
CCGCTCTGGATCGACCCGCAGAAGGGGAGGATCATCCTCGAGAGCTTCAACCCGCTGGCCGAGCAAGCCCAAGAC
TTCCTCATCACCATCTCGGAGCCGCTGTCCCGGCCGACGTTTATGCACGAGTATGCCCTCACGACGCACAGCCTC
TACGCCGCCGTCTCCGTCGGCCTCTCGCCCGACGACATCATCAATACCCTCGAGCGCTTCCTCAAGACGCCGCTC
CCGGACGAGATCCGAGAGTTTATCACGAGCTGCACCCAGAGCTACGGCAAGGTCAAGCTGGTCCTGAAGAATACC
AAGTACTACGTCGAGTCTCCGGATCCGAACATGCTGCAGACGCTGCTCAAGAACCCCAAAATCGGGCCTCTGAGG
GTGCAAGGGACGGAAGAGATCACGACGTCTGCCGCCCCCAAGATCGGCGGCCTCGTCATTCCAGGCACGAAGAAC
GCGGCCGGGGTCAAGCAGGCAAACGGTCTGCAACAGCCCGGCTCGGAGCAGCCCAAGGACGGCCAGCCGGCCCAG
GCGGGAGACGTGCTTGCCGACTTGAACGAGGAGGACGACGAGGACCAGGAAGTGACGCACTCGTTCGAAATCGCC
GACAAGGATGTCGAGACGGTGCAGAAGGAGTGTCTGAACCTCGGCTATCCCGTGCTCGAGGAATACGACTTCCGC
AGGGACGAGGTCAACCCCAACCTCGACATCGACCTCAAGCCCGGCACGCAGATCCGTCCGTACCAGGAGAAGAGC
CTGAGCAAGATGTTCGGCAACGGCCGAGCCAAGAGCGGGCTGATCGTCCTGCCCTGCGGCGCCGGCAAGACGCTC
GTCGGCATCACGGCCGCCTGCACCATCAAAAAGGGCGTCATCGTGCTGTGCACCAGCTCCATGTCGGTGGTGCAG
TGGCGCAACGAGTTTCTGAAGTGGTCCAACATCAACCCGGACGACATCGTGGCCTTTACGTCGGACTCGAAGGGG
TCGGTGTTTACGGGAAGCACGGGCATCATCGTGACGACGTACTCGATGGTGACGCAGTCTCGGGCGCGGTCGTAC
GACGCGGAGAAGATGATGCGGTTCCTGACGGGGCGAGAATGGGGTCTCATGCTGCTGGACGAGGTGCACGTCGTG
CCGGCCAACATCTTCCGCAAGGTGACGTCGTCGATCAAGACGCACTCGAAGCTGGGGCTCACGGCCACGCTGCTC
CGGGAAGACGACAAGATCTCGGACCTCAACTTCCTCATCGGGCCGAAGCTGTTCGAGGCCAACTGGATGGAGCTG
TCGAAGCAGGGCCACATCGCGCGCGTGCAGTGCGCCGAAGTGTGGTGCCCGATGCCGACCGAGTTTTACGACGAG
TACCTGCGGGCGCCGTCGCGCAAGAAGAACCTGCTGTACATTATGAACCCGCGCAAGTTTCAGGCGTGCCAGTAC
CTCATCAACTACCACGAGTCCCGGGGGGACAAGATCATCGTCTTCTCGGACAACGTGTACGCGCTCAAGGCGTAC
GCGCTCAAGCTGGGCAAGGCCTTCATCTACGGCAGCACGGGACAGGCGGAGCGGCTGCAGGTGCTGGAGAACTTC
CAGCACAACCCGCACGTCAACACGCTGTTCCTGTCCAAGATCGGCGACACGTCGCTGGACCTGCCCGAGGCTACG
TGCCTCATCCAGATCTCGTCGCACTACGGCTCGCGCCGTCAGGAGGCGCAGAGACTGGGGCGGATCCTGCGAGCC
AAGCGCAGAAACGACGAGGGCTTCAACGCCTTCTTCTACTCGCTCGTCTCCAAGGACACGCAGGAGATGTACTTT
TCGTCGAAGCGGCAGGCCTTCCTGGTGGACCAGGGGTACGCCTTCAAGGTGATTACGCACCTGGCCAACATCGAG
AAGACGCCGGGGCTCGCGTTCGCGACGGCGAGCGAGCGGCGGGAGCTGCTGCAGAAGGTGCTGGTGGAGAACGAC
ACGATGGAGGACGAGGACATCACGGACGACCTCTTCCACAGCGGCAGCATGGGCCGCAAGAAGAAGAGGGGCGCG
GCGCGGCGGACGGCGGGGACGCTGGGGGAGCTCAGCGGCGGGCAGGACATGGCGTACATTGAGCAGAACAAGAGG
ATGAACCAGGCGCTGAAGAAGGGCAAGGGCAAGAAGGAGAGCAGCTCGTTCTTCAAGAAGATTGGGCGCGAGAAC
GCCCGACGGGCGGCGCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail