Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4147
Gene name
LocationContig_214:6640..9456
Strand+
Gene length (bp)2816
Transcript length (bp)2508
Coding sequence length (bp)2508
Protein length (aa) 836

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00307 CH Calponin homology (CH) domain 1.6E-21 187 291
PF00307 CH Calponin homology (CH) domain 3.5E-22 302 406
PF08726 EFhand_Ca_insen Ca2+ insensitive EF hand 2.7E-25 730 799
PF11971 CAMSAP_CH CAMSAP CH domain 5.4E-07 312 386

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13728|AIN1_SCHPO Alpha-actinin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ain1 PE=3 SV=1 183 805 0.0E+00
sp|P05095|ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum GN=abpA PE=1 SV=2 184 536 5.0E-84
sp|Q2PFV7|ACTN1_MACFA Alpha-actinin-1 OS=Macaca fascicularis GN=ACTN1 PE=2 SV=1 184 558 3.0E-77
sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 184 558 3.0E-77
sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus GN=ACTN1 PE=2 SV=1 184 558 9.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13728|AIN1_SCHPO Alpha-actinin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ain1 PE=3 SV=1 183 805 0.0E+00
sp|P05095|ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum GN=abpA PE=1 SV=2 184 536 5.0E-84
sp|Q2PFV7|ACTN1_MACFA Alpha-actinin-1 OS=Macaca fascicularis GN=ACTN1 PE=2 SV=1 184 558 3.0E-77
sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 184 558 3.0E-77
sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus GN=ACTN1 PE=2 SV=1 184 558 9.0E-77
sp|Q9Z1P2|ACTN1_RAT Alpha-actinin-1 OS=Rattus norvegicus GN=Actn1 PE=1 SV=1 184 558 2.0E-76
sp|O88990|ACTN3_MOUSE Alpha-actinin-3 OS=Mus musculus GN=Actn3 PE=2 SV=1 184 717 2.0E-76
sp|Q08043|ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 184 623 3.0E-76
sp|Q7TPR4|ACTN1_MOUSE Alpha-actinin-1 OS=Mus musculus GN=Actn1 PE=1 SV=1 184 558 3.0E-76
sp|P05094|ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus GN=ACTN1 PE=1 SV=3 184 558 4.0E-76
sp|Q0III9|ACTN3_BOVIN Alpha-actinin-3 OS=Bos taurus GN=ACTN3 PE=2 SV=1 184 644 7.0E-76
sp|Q3ZC55|ACTN2_BOVIN Alpha-actinin-2 OS=Bos taurus GN=ACTN2 PE=2 SV=1 184 558 2.0E-75
sp|Q9JI91|ACTN2_MOUSE Alpha-actinin-2 OS=Mus musculus GN=Actn2 PE=1 SV=2 184 558 2.0E-75
sp|Q9QXQ0|ACTN4_RAT Alpha-actinin-4 OS=Rattus norvegicus GN=Actn4 PE=1 SV=2 184 558 2.0E-75
sp|P35609|ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 184 558 3.0E-75
sp|P57780|ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus GN=Actn4 PE=1 SV=1 184 558 3.0E-75
sp|P20111|ACTN2_CHICK Alpha-actinin-2 OS=Gallus gallus GN=ACTN2 PE=2 SV=1 184 558 4.0E-75
sp|A5D7D1|ACTN4_BOVIN Alpha-actinin-4 OS=Bos taurus GN=ACTN4 PE=2 SV=1 184 558 9.0E-75
sp|Q90734|ACTN4_CHICK Alpha-actinin-4 OS=Gallus gallus GN=ACTN4 PE=1 SV=1 184 558 1.0E-74
sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 184 558 2.0E-74
sp|Q5RCS6|ACTN4_PONAB Alpha-actinin-4 OS=Pongo abelii GN=ACTN4 PE=2 SV=1 184 558 5.0E-74
sp|P15508|SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus GN=Sptb PE=1 SV=4 186 561 1.0E-72
sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2 187 557 1.0E-72
sp|Q62261|SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus GN=Sptbn1 PE=1 SV=2 187 557 2.0E-72
sp|P11277|SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5 186 557 4.0E-72
sp|Q00963|SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster GN=beta-Spec PE=1 SV=2 186 542 6.0E-72
sp|Q9H254|SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2 186 560 4.0E-71
sp|Q9QWN8|SPTN2_RAT Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus GN=Sptbn2 PE=1 SV=2 187 546 2.0E-70
sp|O15020|SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3 186 546 7.0E-70
sp|Q7PKQ5|ACTN_ANOGA Alpha-actinin, sarcomeric OS=Anopheles gambiae GN=Actn PE=3 SV=2 184 543 4.0E-69
sp|P18091|ACTN_DROME Alpha-actinin, sarcomeric OS=Drosophila melanogaster GN=Actn PE=1 SV=2 184 543 9.0E-69
sp|Q9NRC6|SPTN5_HUMAN Spectrin beta chain, non-erythrocytic 5 OS=Homo sapiens GN=SPTBN5 PE=1 SV=2 181 535 1.0E-57
sp|Q9QXZ0|MACF1_MOUSE Microtubule-actin cross-linking factor 1 OS=Mus musculus GN=Macf1 PE=1 SV=2 131 568 8.0E-56
sp|D3ZHV2|MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus GN=Macf1 PE=1 SV=1 131 568 2.0E-55
sp|Q9UPN3|MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens GN=MACF1 PE=1 SV=4 131 568 7.0E-55
sp|Q03001|DYST_HUMAN Dystonin OS=Homo sapiens GN=DST PE=1 SV=4 187 568 8.0E-55
sp|Q91ZU6|DYST_MOUSE Dystonin OS=Mus musculus GN=Dst PE=1 SV=2 187 581 6.0E-54
sp|Q15149|PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 187 476 4.0E-52
sp|P30427|PLEC_RAT Plectin OS=Rattus norvegicus GN=Plec PE=1 SV=2 187 527 9.0E-51
sp|Q9QXS1|PLEC_MOUSE Plectin OS=Mus musculus GN=Plec PE=1 SV=3 187 527 2.0E-50
sp|P13466|GELA_DICDI Gelation factor OS=Dictyostelium discoideum GN=abpC PE=1 SV=1 182 401 2.0E-48
sp|Q54HG2|CTXA_DICDI Cortexillin-1 OS=Dictyostelium discoideum GN=ctxA PE=1 SV=1 184 409 2.0E-48
sp|Q9Y0T4|CTXA_POLPA Cortexillin-1 OS=Polysphondylium pallidum GN=ctxA PE=3 SV=1 184 412 2.0E-45
sp|Q550R2|CTXB_DICDI Cortexillin-2 OS=Dictyostelium discoideum GN=ctxB PE=1 SV=1 182 412 7.0E-44
sp|Q9JI55|PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus GN=PLEC PE=1 SV=1 216 527 8.0E-43
sp|Q8NF91|SYNE1_HUMAN Nesprin-1 OS=Homo sapiens GN=SYNE1 PE=1 SV=4 187 454 4.0E-42
sp|Q9Y0T3|CTXB_POLPA Cortexillin-2 OS=Polysphondylium pallidum GN=ctxB PE=3 SV=1 181 455 2.0E-41
sp|O76329|ACTNB_DICDI Interaptin OS=Dictyostelium discoideum GN=abpD PE=1 SV=1 184 407 5.0E-41
sp|P11533|DMD_CHICK Dystrophin OS=Gallus gallus GN=DMD PE=2 SV=1 187 419 7.0E-41
sp|Q6ZWR6|SYNE1_MOUSE Nesprin-1 OS=Mus musculus GN=Syne1 PE=1 SV=2 187 454 2.0E-40
sp|Q8C5W0|CLMN_MOUSE Calmin OS=Mus musculus GN=Clmn PE=1 SV=2 187 437 2.0E-40
sp|Q8WXH0|SYNE2_HUMAN Nesprin-2 OS=Homo sapiens GN=SYNE2 PE=1 SV=3 187 403 5.0E-40
sp|Q6ZWQ0|SYNE2_MOUSE Nesprin-2 OS=Mus musculus GN=Syne2 PE=1 SV=2 172 402 9.0E-39
sp|Q96JQ2|CLMN_HUMAN Calmin OS=Homo sapiens GN=CLMN PE=1 SV=1 186 409 2.0E-38
sp|P11531|DMD_MOUSE Dystrophin OS=Mus musculus GN=Dmd PE=1 SV=3 187 412 1.0E-37
sp|P11530|DMD_RAT Dystrophin OS=Rattus norvegicus GN=Dmd PE=1 SV=2 187 419 1.0E-37
sp|P11532|DMD_HUMAN Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3 187 412 2.0E-37
sp|Q5GN48|DMD_PIG Dystrophin OS=Sus scrofa GN=DMD PE=1 SV=1 187 412 9.0E-37
sp|O97592|DMD_CANLF Dystrophin OS=Canis lupus familiaris GN=DMD PE=2 SV=1 187 412 1.0E-36
sp|Q8VHX6|FLNC_MOUSE Filamin-C OS=Mus musculus GN=Flnc PE=1 SV=3 153 399 3.0E-36
sp|P46939|UTRO_HUMAN Utrophin OS=Homo sapiens GN=UTRN PE=1 SV=2 187 421 4.0E-36
sp|D3ZHA0|FLNC_RAT Filamin-C OS=Rattus norvegicus GN=Flnc PE=1 SV=1 153 399 7.0E-36
sp|Q9VEN1|FLNA_DROME Filamin-A OS=Drosophila melanogaster GN=cher PE=1 SV=2 174 401 2.0E-35
sp|P18091|ACTN_DROME Alpha-actinin, sarcomeric OS=Drosophila melanogaster GN=Actn PE=1 SV=2 511 795 1.0E-33
sp|Q14315|FLNC_HUMAN Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 154 399 1.0E-33
sp|Q8BTM8|FLNA_MOUSE Filamin-A OS=Mus musculus GN=Flna PE=1 SV=5 151 399 2.0E-33
sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/F/G/H OS=Drosophila melanogaster GN=Dys PE=1 SV=3 187 408 3.0E-33
sp|Q7PKQ5|ACTN_ANOGA Alpha-actinin, sarcomeric OS=Anopheles gambiae GN=Actn PE=3 SV=2 511 795 7.0E-33
sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 160 399 1.0E-32
sp|O75369|FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 178 399 1.0E-30
sp|Q80X90|FLNB_MOUSE Filamin-B OS=Mus musculus GN=Flnb PE=1 SV=3 178 399 2.0E-30
sp|P35609|ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 485 779 1.0E-27
sp|P05095|ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum GN=abpA PE=1 SV=2 520 799 2.0E-27
sp|Q9JI91|ACTN2_MOUSE Alpha-actinin-2 OS=Mus musculus GN=Actn2 PE=1 SV=2 485 779 2.0E-27
sp|P20111|ACTN2_CHICK Alpha-actinin-2 OS=Gallus gallus GN=ACTN2 PE=2 SV=1 415 779 2.0E-27
sp|Q3ZC55|ACTN2_BOVIN Alpha-actinin-2 OS=Bos taurus GN=ACTN2 PE=2 SV=1 485 779 4.0E-27
sp|Q90734|ACTN4_CHICK Alpha-actinin-4 OS=Gallus gallus GN=ACTN4 PE=1 SV=1 415 795 3.0E-26
sp|Q8N3F8|MILK1_HUMAN MICAL-like protein 1 OS=Homo sapiens GN=MICALL1 PE=1 SV=2 306 405 4.0E-26
sp|Q0III9|ACTN3_BOVIN Alpha-actinin-3 OS=Bos taurus GN=ACTN3 PE=2 SV=1 401 802 6.0E-26
sp|E1BBG2|MILK1_BOVIN MICAL-like protein 1 OS=Bos taurus GN=MICALL1 PE=1 SV=2 306 406 8.0E-26
sp|O88990|ACTN3_MOUSE Alpha-actinin-3 OS=Mus musculus GN=Actn3 PE=2 SV=1 486 802 3.0E-25
sp|Q8BGT6|MILK1_MOUSE MICAL-like protein 1 OS=Mus musculus GN=Micall1 PE=1 SV=3 306 406 4.0E-25
sp|D3ZQL6|MILK1_RAT MICAL-like protein 1 OS=Rattus norvegicus GN=Micall1 PE=1 SV=1 306 406 4.0E-25
sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus GN=ACTN1 PE=2 SV=1 524 795 5.0E-25
sp|Q7TPR4|ACTN1_MOUSE Alpha-actinin-1 OS=Mus musculus GN=Actn1 PE=1 SV=1 524 795 6.0E-25
sp|P05094|ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus GN=ACTN1 PE=1 SV=3 524 795 6.0E-25
sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 415 780 6.0E-25
sp|Q5RCS6|ACTN4_PONAB Alpha-actinin-4 OS=Pongo abelii GN=ACTN4 PE=2 SV=1 415 780 6.0E-25
sp|Q2PFV7|ACTN1_MACFA Alpha-actinin-1 OS=Macaca fascicularis GN=ACTN1 PE=2 SV=1 524 795 9.0E-25
sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 524 795 9.0E-25
sp|Q9Z1P2|ACTN1_RAT Alpha-actinin-1 OS=Rattus norvegicus GN=Actn1 PE=1 SV=1 524 795 1.0E-24
sp|Q9QXQ0|ACTN4_RAT Alpha-actinin-4 OS=Rattus norvegicus GN=Actn4 PE=1 SV=2 415 795 2.0E-24
sp|P57780|ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus GN=Actn4 PE=1 SV=1 415 795 4.0E-24
sp|A5D7D1|ACTN4_BOVIN Alpha-actinin-4 OS=Bos taurus GN=ACTN4 PE=2 SV=1 415 780 5.0E-24
sp|D3ZEN0|MILK2_RAT MICAL-like protein 2 OS=Rattus norvegicus GN=Micall2 PE=1 SV=2 300 405 7.0E-23
sp|Q08043|ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 401 802 8.0E-23
sp|Q3TN34|MILK2_MOUSE MICAL-like protein 2 OS=Mus musculus GN=Micall2 PE=1 SV=1 300 405 1.0E-22
sp|Q8CJ19|MICA3_MOUSE Protein-methionine sulfoxide oxidase MICAL3 OS=Mus musculus GN=Mical3 PE=1 SV=2 229 405 1.0E-22
sp|Q7RTP6|MICA3_HUMAN Protein-methionine sulfoxide oxidase MICAL3 OS=Homo sapiens GN=MICAL3 PE=1 SV=2 229 405 5.0E-22
sp|Q8IY33|MILK2_HUMAN MICAL-like protein 2 OS=Homo sapiens GN=MICALL2 PE=1 SV=1 300 405 1.0E-21
sp|G3MWR8|MICA3_BOVIN Protein-methionine sulfoxide oxidase MICAL3 OS=Bos taurus GN=MICAL3 PE=3 SV=1 229 405 2.0E-21
sp|Q2KN93|CYTSA_DANRE Cytospin-A OS=Danio rerio GN=specc1la PE=2 SV=2 297 405 2.0E-21
sp|F1QH17|MCA3A_DANRE Protein-methionine sulfoxide oxidase mical3a OS=Danio rerio GN=mical3a PE=2 SV=2 298 405 4.0E-21
sp|Q2KN96|CYTSA_XENTR Cytospin-A OS=Xenopus tropicalis GN=specc1l PE=2 SV=1 297 405 1.0E-20
sp|Q2KNA0|CYTSA_CANLF Cytospin-A OS=Canis lupus familiaris GN=SPECC1L PE=2 SV=1 297 405 1.0E-20
sp|Q2KN94|CYTSA_TAKRU Cytospin-A OS=Takifugu rubripes GN=specc1l PE=2 SV=1 297 405 2.0E-20
sp|Q2KNA1|CYTSA_PANTR Cytospin-A OS=Pan troglodytes GN=SPECC1L PE=2 SV=1 297 405 3.0E-20
sp|Q69YQ0|CYTSA_HUMAN Cytospin-A OS=Homo sapiens GN=SPECC1L PE=1 SV=2 297 405 3.0E-20
sp|Q2KN98|CYTSA_MOUSE Cytospin-A OS=Mus musculus GN=Specc1l PE=1 SV=1 297 405 7.0E-20
sp|Q2KN97|CYTSA_CHICK Cytospin-A OS=Gallus gallus GN=SPECC1L PE=2 SV=2 297 405 8.0E-20
sp|Q2KN95|CYTSA_TETNG Cytospin-A OS=Tetraodon nigroviridis GN=specc1l PE=2 SV=1 297 405 8.0E-20
sp|Q2KN99|CYTSA_RAT Cytospin-A OS=Rattus norvegicus GN=Specc1l PE=1 SV=1 297 405 3.0E-19
sp|Q2KI85|SMTL2_BOVIN Smoothelin-like protein 2 OS=Bos taurus GN=SMTNL2 PE=2 SV=1 301 409 6.0E-19
sp|Q8CI12|SMTL2_MOUSE Smoothelin-like protein 2 OS=Mus musculus GN=Smtnl2 PE=1 SV=1 301 409 1.0E-18
sp|O94851|MICA2_HUMAN Protein-methionine sulfoxide oxidase MICAL2 OS=Homo sapiens GN=MICAL2 PE=1 SV=1 306 405 1.0E-18
sp|Q5M775|CYTSB_HUMAN Cytospin-B OS=Homo sapiens GN=SPECC1 PE=1 SV=1 297 405 3.0E-18
sp|P02549|SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens GN=SPTA1 PE=1 SV=5 508 795 5.0E-18
sp|F6QZ15|MICA2_XENTR Protein-methionine sulfoxide oxidase mical2 OS=Xenopus tropicalis GN=mical2 PE=3 SV=1 306 405 6.0E-18
sp|Q2TAL5|SMTL2_HUMAN Smoothelin-like protein 2 OS=Homo sapiens GN=SMTNL2 PE=2 SV=1 301 409 6.0E-18
sp|Q9N4M4|ANC1_CAEEL Nuclear anchorage protein 1 OS=Caenorhabditis elegans GN=anc-1 PE=1 SV=3 188 292 7.0E-18
sp|F1MF74|MICA2_BOVIN Protein-methionine sulfoxide oxidase MICAL2 OS=Bos taurus GN=MICAL2 PE=3 SV=2 306 405 8.0E-18
sp|Q8NDI1|EHBP1_HUMAN EH domain-binding protein 1 OS=Homo sapiens GN=EHBP1 PE=1 SV=3 301 409 1.0E-17
sp|Q13813|SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3 494 800 1.0E-17
sp|P16546|SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus GN=Sptan1 PE=1 SV=4 494 800 1.0E-17
sp|P07751|SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus GN=SPTAN1 PE=1 SV=3 494 800 2.0E-17
sp|P16086|SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus GN=Sptan1 PE=1 SV=2 494 800 2.0E-17
sp|P13395|SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster GN=alpha-Spec PE=1 SV=2 494 802 2.0E-17
sp|A8MU46|SMTL1_HUMAN Smoothelin-like protein 1 OS=Homo sapiens GN=SMTNL1 PE=1 SV=1 306 407 3.0E-17
sp|D4A1F2|MICA2_RAT Protein-methionine sulfoxide oxidase MICAL2 OS=Rattus norvegicus GN=Mical2 PE=3 SV=1 306 405 3.0E-17
sp|Q69ZW3|EHBP1_MOUSE EH domain-binding protein 1 OS=Mus musculus GN=Ehbp1 PE=1 SV=3 301 409 4.0E-17
sp|Q5SXY1|CYTSB_MOUSE Cytospin-B OS=Mus musculus GN=Specc1 PE=1 SV=2 297 405 4.0E-17
sp|F1RA39|MCA2B_DANRE Protein-methionine sulfoxide oxidase mical2b OS=Danio rerio GN=mical2b PE=2 SV=2 306 405 4.0E-17
sp|Q8BML1|MICA2_MOUSE Protein-methionine sulfoxide oxidase MICAL2 OS=Mus musculus GN=Mical2 PE=1 SV=1 306 405 4.0E-17
sp|E7F9T0|MICA1_DANRE Protein-methionine sulfoxide oxidase mical1 OS=Danio rerio GN=mical1 PE=3 SV=1 304 407 2.0E-16
sp|Q99LM3|SMTL1_MOUSE Smoothelin-like protein 1 OS=Mus musculus GN=Smtnl1 PE=1 SV=1 306 407 3.0E-16
sp|Q921U8|SMTN_MOUSE Smoothelin OS=Mus musculus GN=Smtn PE=1 SV=2 301 409 5.0E-16
sp|P53814|SMTN_HUMAN Smoothelin OS=Homo sapiens GN=SMTN PE=1 SV=7 301 409 2.0E-15
sp|F1QWK4|MCA3B_DANRE Protein-methionine sulfoxide oxidase mical3b OS=Danio rerio GN=mical3b PE=3 SV=2 261 399 3.0E-15
sp|Q8N3D4|EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens GN=EHBP1L1 PE=1 SV=2 300 415 6.0E-15
sp|Q99MS7|EH1L1_MOUSE EH domain-binding protein 1-like protein 1 OS=Mus musculus GN=Ehbp1l1 PE=1 SV=1 300 426 1.0E-14
sp|P08032|SPTA1_MOUSE Spectrin alpha chain, erythrocytic 1 OS=Mus musculus GN=Spta1 PE=1 SV=3 508 795 3.0E-14
sp|Q75JP5|Y2471_DICDI Calponin homology domain-containing protein DDB_G0272472 OS=Dictyostelium discoideum GN=DDB_G0272472 PE=3 SV=1 299 407 3.0E-14
sp|Q9N4M4|ANC1_CAEEL Nuclear anchorage protein 1 OS=Caenorhabditis elegans GN=anc-1 PE=1 SV=3 322 407 5.0E-14
sp|Q7G188|FIMB1_ARATH Fimbrin-1 OS=Arabidopsis thaliana GN=FIM1 PE=1 SV=2 189 401 4.0E-12
sp|Q8VDP3|MICA1_MOUSE Protein-methionine sulfoxide oxidase MICAL1 OS=Mus musculus GN=Mical1 PE=1 SV=1 299 405 8.0E-12
sp|Q1ZXH8|GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum GN=gxcDD PE=3 SV=3 179 293 2.0E-11
sp|F1MH07|MICA1_BOVIN Protein-methionine sulfoxide oxidase MICAL1 OS=Bos taurus GN=MICAL1 PE=2 SV=1 300 405 4.0E-11
sp|Q5TZ18|NAV3_DANRE Neuron navigator 3 OS=Danio rerio GN=nav3 PE=3 SV=1 167 286 9.0E-11
sp|Q8TDZ2|MICA1_HUMAN Protein-methionine sulfoxide oxidase MICAL1 OS=Homo sapiens GN=MICAL1 PE=1 SV=2 303 408 1.0E-10
sp|P32599|FIMB_YEAST Fimbrin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC6 PE=1 SV=1 188 399 3.0E-10
sp|Q9FKI0|FIMB5_ARATH Fimbrin-5 OS=Arabidopsis thaliana GN=FIM5 PE=1 SV=1 169 401 3.0E-10
sp|D3ZBP4|MICA1_RAT Protein-methionine sulfoxide oxidase MICAL1 OS=Rattus norvegicus GN=Mical1 PE=1 SV=1 299 405 6.0E-10
sp|Q8IVL1|NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens GN=NAV2 PE=1 SV=3 192 286 7.0E-10
sp|Q8IVL0|NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens GN=NAV3 PE=1 SV=3 190 286 8.0E-10
sp|Q80TN7|NAV3_MOUSE Neuron navigator 3 OS=Mus musculus GN=Nav3 PE=1 SV=2 190 286 8.0E-10
sp|O50064|FIMB2_ARATH Fimbrin-2 OS=Arabidopsis thaliana GN=FIM2 PE=2 SV=1 185 401 1.0E-09
sp|P62285|ASPM_BOVIN Abnormal spindle-like microcephaly-associated protein homolog (Fragment) OS=Bos taurus GN=ASPM PE=2 SV=1 204 419 2.0E-09
sp|P62297|ASPM_SHEEP Abnormal spindle-like microcephaly-associated protein homolog (Fragment) OS=Ovis aries GN=ASPM PE=2 SV=1 204 419 2.0E-09
sp|Q155Q3|DIXC1_HUMAN Dixin OS=Homo sapiens GN=DIXDC1 PE=1 SV=2 188 290 2.0E-09
sp|Q2VUH7|DIXC1_RAT Dixin OS=Rattus norvegicus GN=Dixdc1 PE=2 SV=1 188 290 5.0E-09
sp|Q9TW65|DMD_CAEEL Dystrophin-1 OS=Caenorhabditis elegans GN=dys-1 PE=1 SV=2 263 412 9.0E-09
sp|A7E3Q8|PLST_BOVIN Plastin-3 OS=Bos taurus GN=PLS3 PE=2 SV=1 186 368 2.0E-08
sp|Q9SJ84|FIMB4_ARATH Fimbrin-4 OS=Arabidopsis thaliana GN=FIM4 PE=3 SV=1 188 401 2.0E-08
sp|P13797|PLST_HUMAN Plastin-3 OS=Homo sapiens GN=PLS3 PE=1 SV=4 186 368 3.0E-08
sp|Q99K51|PLST_MOUSE Plastin-3 OS=Mus musculus GN=Pls3 PE=1 SV=3 186 368 4.0E-08
sp|P13796|PLSL_HUMAN Plastin-2 OS=Homo sapiens GN=LCP1 PE=1 SV=6 186 299 4.0E-08
sp|O88818|PLST_CRIGR Plastin-3 OS=Cricetulus griseus GN=PLS3 PE=2 SV=3 186 368 5.0E-08
sp|Q61233|PLSL_MOUSE Plastin-2 OS=Mus musculus GN=Lcp1 PE=1 SV=4 148 446 5.0E-08
sp|Q6P698|PLSL_DANRE Plastin-2 OS=Danio rerio GN=lcp1 PE=2 SV=1 147 413 9.0E-08
sp|P13796|PLSL_HUMAN Plastin-2 OS=Homo sapiens GN=LCP1 PE=1 SV=6 148 446 1.0E-07
sp|Q6P698|PLSL_DANRE Plastin-2 OS=Danio rerio GN=lcp1 PE=2 SV=1 186 356 1.0E-07
sp|Q9FJ70|FIMB3_ARATH Fimbrin-3 OS=Arabidopsis thaliana GN=FIM3 PE=3 SV=1 189 401 2.0E-07
sp|Q1ZXE2|Y7875_DICDI PH domain-containing protein DDB_G0287875 OS=Dictyostelium discoideum GN=DDB_G0287875 PE=2 SV=1 191 409 2.0E-07
sp|Q61233|PLSL_MOUSE Plastin-2 OS=Mus musculus GN=Lcp1 PE=1 SV=4 186 299 3.0E-07
sp|Q63598|PLST_RAT Plastin-3 OS=Rattus norvegicus GN=Pls3 PE=1 SV=2 186 368 3.0E-07
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 657 796 5.0E-07
sp|P62296|ASPM_SAIBB Abnormal spindle-like microcephaly-associated protein homolog OS=Saimiri boliviensis boliviensis GN=ASPM PE=2 SV=1 204 354 7.0E-07
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 657 800 7.0E-07
sp|P32599|FIMB_YEAST Fimbrin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC6 PE=1 SV=1 140 296 1.0E-06
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 657 791 1.0E-06
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 657 796 1.0E-06
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 657 796 2.0E-06
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 657 796 2.0E-06
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 647 796 2.0E-06
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 657 800 2.0E-06
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 657 800 2.0E-06
sp|P62286|ASPM_CANLF Abnormal spindle-like microcephaly-associated protein homolog OS=Canis lupus familiaris GN=ASPM PE=2 SV=2 204 419 2.0E-06
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 657 796 2.0E-06
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 657 796 2.0E-06
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 657 796 2.0E-06
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 657 796 2.0E-06
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 657 796 2.0E-06
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 657 796 2.0E-06
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 657 796 2.0E-06
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 657 796 2.0E-06
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 657 796 2.0E-06
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 657 796 2.0E-06
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 657 796 2.0E-06
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 657 796 2.0E-06
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 657 796 2.0E-06
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 657 796 2.0E-06
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 657 796 2.0E-06
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 657 796 2.0E-06
sp|Q14651|PLSI_HUMAN Plastin-1 OS=Homo sapiens GN=PLS1 PE=1 SV=2 188 399 2.0E-06
sp|Q9FKI0|FIMB5_ARATH Fimbrin-5 OS=Arabidopsis thaliana GN=FIM5 PE=1 SV=1 209 385 3.0E-06
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 657 796 3.0E-06
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 657 791 3.0E-06
sp|Q9SJ84|FIMB4_ARATH Fimbrin-4 OS=Arabidopsis thaliana GN=FIM4 PE=3 SV=1 209 345 4.0E-06
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 657 770 4.0E-06
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 657 796 4.0E-06
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 657 796 4.0E-06
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 657 796 4.0E-06
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 657 796 4.0E-06
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 657 796 4.0E-06
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 657 796 4.0E-06
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 657 796 4.0E-06
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 657 796 4.0E-06
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 657 796 5.0E-06
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 656 770 5.0E-06
sp|A6H742|PLSI_BOVIN Plastin-1 OS=Bos taurus GN=PLS1 PE=2 SV=1 188 399 6.0E-06
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 657 796 6.0E-06
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 657 796 6.0E-06
sp|Q9D6P8|CALL3_MOUSE Calmodulin-like protein 3 OS=Mus musculus GN=Calml3 PE=2 SV=1 657 801 6.0E-06
sp|P19179|PLSI_CHICK Plastin-1 OS=Gallus gallus GN=PLS1 PE=1 SV=1 177 414 6.0E-06
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 657 796 6.0E-06
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 657 796 7.0E-06
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 657 796 7.0E-06
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 657 796 7.0E-06
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 657 796 7.0E-06
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 657 796 8.0E-06
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 657 801 8.0E-06
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 657 796 8.0E-06
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 657 796 9.0E-06
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 657 796 9.0E-06
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 657 796 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4147
MAAAAPGDDGAPQRSPSLQPGNAEGVERFPQFCLQASSADDGPKQPPQHRSHDHHHSTSSAADGPPSSVCPGSPV
SSKSSRSPTASSVSTAATSVDSDSLLPPEASLRRRAPTQRSRRDKKSLHAARQQRSASDRQPLGSKPKGSKGKRF
QRSSNSSPADALAAVEPAHEQGLAKMTFAEQQRWITVQQKTFTKWLNTKLVARDLEVTDLVKDLSDGVILIHLLE
CLSSESLGRYASKPKLRVQRFENANLALDFIKSRGIQMTNIGAEDVVDGNRKIVLGLIWTLILRFTISEINEEGI
SAKEGLLLWCQRKTACYDEVEVRDFSGSWNDGLAFCALLDIHRPDLIDFDALDKSDHRGNMQLAFDIAHEEIGIP
RLLDVEDVCDMAKPDERSLMTYIAYWFHAFSQMEKVENAGRRVEKFVNNMQGAWEMQSAFERRMRELLKSIRGQV
DQWQQAKFEGTYADAKAQANQFAGYKRGQKRDWVAEKSDLATLLGNIKTKLGTYRLRPYEPPAELRLEVLERDWS
TLAQVEMKRAQLINETIRDIKNALRKSFADKANDLAMALNTMQLAISGLDGDVEDQLHHVRRLSDNLAPLDRYLE
TIAAVDAKCQEANIEENDFTTYTYDELSYELGLVKTSVQKKLSFLENQMVARNMTNLTPIQLEEFESVFRHFDRD
DTNSLQELEFSAALASLGLVFSEDEMHEYFLETSNGRDYVTFEQFIRFMVDVTEDQNTAEQVFQSFREVADGKPY
VTEMDLRHSLVPDEVIDQLVEMMPSHKGPDMSADRGQPQYDYISFMEKLINDEREAEEAPAAVLQDRVNVGDTGP
PRSSKLNGTS*
Coding >Hirsu2|4147
ATGGCGGCAGCCGCTCCAGGGGACGATGGCGCGCCCCAGCGGAGCCCATCGCTACAGCCCGGCAACGCGGAGGGA
GTCGAGCGCTTCCCCCAATTTTGTTTACAAGCCTCGAGCGCCGACGACGGACCAAAGCAGCCGCCGCAGCATCGC
AGCCACGACCATCATCACAGCACCTCTTCTGCCGCCGACGGCCCGCCCAGCAGCGTCTGCCCCGGCTCGCCCGTC
TCGTCCAAGTCGTCGCGCTCGCCGACGGCTTCGAGCGTCTCCACCGCCGCCACCAGCGTCGACTCCGACTCTCTT
CTGCCGCCCGAGGCCTCGCTCCGGCGTCGCGCCCCCACCCAGCGGAGCAGGCGGGACAAGAAGTCGCTGCATGCT
GCACGCCAGCAGCGGTCAGCAAGCGACAGGCAGCCGTTGGGCTCCAAGCCAAAGGGGTCAAAGGGGAAGCGCTTC
CAACGGAGCTCCAACAGCAGCCCGGCCGACGCCCTCGCCGCCGTTGAGCCTGCGCACGAACAGGGTCTCGCCAAG
ATGACCTTCGCCGAGCAGCAGCGCTGGATCACGGTCCAGCAGAAGACGTTTACCAAATGGCTAAACACCAAGCTG
GTTGCCCGAGACCTCGAGGTTACGGACCTCGTCAAGGACCTCAGCGATGGTGTCATATTGATTCATCTTCTCGAA
TGCCTGTCGAGCGAGTCACTCGGCCGCTATGCGTCGAAACCGAAGCTGCGCGTCCAACGGTTCGAAAATGCCAAC
CTCGCTCTCGACTTCATCAAGTCGAGGGGCATCCAGATGACAAACATTGGCGCCGAGGATGTCGTCGACGGCAAC
CGCAAGATCGTCCTGGGCCTCATCTGGACGCTGATCCTGCGCTTCACCATTAGCGAGATCAACGAGGAGGGCATC
TCGGCCAAGGAGGGCTTGCTTCTGTGGTGCCAGCGCAAGACGGCGTGCTACGACGAGGTCGAGGTCCGCGACTTC
AGCGGCAGCTGGAACGACGGCCTGGCCTTCTGCGCGCTGCTCGACATCCACCGACCCGACCTGATCGACTTTGAC
GCCCTCGACAAGTCGGACCATCGCGGCAACATGCAGCTGGCCTTCGACATCGCCCACGAGGAGATTGGCATCCCC
CGGCTGCTCGACGTCGAGGACGTCTGCGACATGGCCAAGCCCGACGAGCGAAGCTTGATGACGTACATTGCATAC
TGGTTCCACGCCTTTTCGCAGATGGAAAAGGTCGAAAACGCCGGCCGGCGGGTGGAAAAATTCGTCAACAACATG
CAGGGCGCCTGGGAGATGCAGAGCGCCTTTGAGCGGCGCATGCGGGAGCTGCTCAAGTCCATCAGGGGGCAGGTT
GACCAGTGGCAGCAGGCCAAGTTTGAGGGCACGTATGCCGATGCCAAGGCGCAGGCAAACCAGTTCGCCGGCTAC
AAGAGGGGCCAAAAACGAGACTGGGTGGCCGAGAAGAGCGACCTGGCCACCCTACTGGGCAACATCAAGACCAAA
CTGGGAACCTATCGTCTCCGCCCTTATGAGCCCCCGGCGGAGCTGCGGCTCGAGGTTCTGGAGCGTGACTGGAGC
ACGCTCGCACAGGTGGAGATGAAACGGGCTCAGCTCATCAACGAGACCATCCGAGACATCAAAAACGCCCTGCGA
AAGTCCTTCGCCGACAAGGCCAACGACCTGGCCATGGCCCTCAACACCATGCAGCTGGCGATATCGGGCCTCGAC
GGCGACGTCGAAGACCAGCTGCACCACGTGAGGAGGCTGAGCGACAACCTGGCACCGCTGGACCGCTACCTCGAG
ACCATCGCCGCCGTGGACGCCAAGTGTCAAGAGGCCAACATCGAGGAGAATGACTTTACGACGTACACGTACGAC
GAGCTGTCGTACGAGCTCGGCCTGGTCAAGACGTCGGTGCAGAAGAAGCTGTCCTTCCTGGAGAACCAGATGGTG
GCGCGCAACATGACGAACCTGACGCCGATCCAGCTCGAGGAGTTCGAGAGCGTCTTCCGGCACTTCGACCGGGAC
GACACCAACTCGCTGCAGGAGCTCGAGTTCAGCGCGGCGCTGGCCTCGCTCGGCCTGGTCTTCTCCGAGGACGAG
ATGCACGAGTACTTCCTGGAGACGTCCAACGGCCGCGACTACGTCACCTTTGAGCAGTTCATCCGCTTCATGGTG
GACGTGACCGAGGACCAGAACACGGCGGAGCAGGTGTTCCAGTCGTTCCGCGAGGTGGCCGACGGCAAGCCGTAC
GTGACCGAGATGGACCTGCGGCACAGCCTGGTGCCGGACGAGGTGATTGACCAGCTCGTCGAGATGATGCCCTCG
CACAAGGGGCCCGACATGTCGGCGGACCGCGGCCAGCCGCAGTACGACTACATCAGCTTCATGGAGAAGCTCATC
AACGACGAGCGGGAGGCTGAGGAGGCGCCGGCCGCGGTGCTGCAGGACCGGGTCAACGTGGGCGACACAGGGCCC
CCGCGGAGCTCGAAGCTGAACGGCACGAGTTAG
Transcript >Hirsu2|4147
ATGGCGGCAGCCGCTCCAGGGGACGATGGCGCGCCCCAGCGGAGCCCATCGCTACAGCCCGGCAACGCGGAGGGA
GTCGAGCGCTTCCCCCAATTTTGTTTACAAGCCTCGAGCGCCGACGACGGACCAAAGCAGCCGCCGCAGCATCGC
AGCCACGACCATCATCACAGCACCTCTTCTGCCGCCGACGGCCCGCCCAGCAGCGTCTGCCCCGGCTCGCCCGTC
TCGTCCAAGTCGTCGCGCTCGCCGACGGCTTCGAGCGTCTCCACCGCCGCCACCAGCGTCGACTCCGACTCTCTT
CTGCCGCCCGAGGCCTCGCTCCGGCGTCGCGCCCCCACCCAGCGGAGCAGGCGGGACAAGAAGTCGCTGCATGCT
GCACGCCAGCAGCGGTCAGCAAGCGACAGGCAGCCGTTGGGCTCCAAGCCAAAGGGGTCAAAGGGGAAGCGCTTC
CAACGGAGCTCCAACAGCAGCCCGGCCGACGCCCTCGCCGCCGTTGAGCCTGCGCACGAACAGGGTCTCGCCAAG
ATGACCTTCGCCGAGCAGCAGCGCTGGATCACGGTCCAGCAGAAGACGTTTACCAAATGGCTAAACACCAAGCTG
GTTGCCCGAGACCTCGAGGTTACGGACCTCGTCAAGGACCTCAGCGATGGTGTCATATTGATTCATCTTCTCGAA
TGCCTGTCGAGCGAGTCACTCGGCCGCTATGCGTCGAAACCGAAGCTGCGCGTCCAACGGTTCGAAAATGCCAAC
CTCGCTCTCGACTTCATCAAGTCGAGGGGCATCCAGATGACAAACATTGGCGCCGAGGATGTCGTCGACGGCAAC
CGCAAGATCGTCCTGGGCCTCATCTGGACGCTGATCCTGCGCTTCACCATTAGCGAGATCAACGAGGAGGGCATC
TCGGCCAAGGAGGGCTTGCTTCTGTGGTGCCAGCGCAAGACGGCGTGCTACGACGAGGTCGAGGTCCGCGACTTC
AGCGGCAGCTGGAACGACGGCCTGGCCTTCTGCGCGCTGCTCGACATCCACCGACCCGACCTGATCGACTTTGAC
GCCCTCGACAAGTCGGACCATCGCGGCAACATGCAGCTGGCCTTCGACATCGCCCACGAGGAGATTGGCATCCCC
CGGCTGCTCGACGTCGAGGACGTCTGCGACATGGCCAAGCCCGACGAGCGAAGCTTGATGACGTACATTGCATAC
TGGTTCCACGCCTTTTCGCAGATGGAAAAGGTCGAAAACGCCGGCCGGCGGGTGGAAAAATTCGTCAACAACATG
CAGGGCGCCTGGGAGATGCAGAGCGCCTTTGAGCGGCGCATGCGGGAGCTGCTCAAGTCCATCAGGGGGCAGGTT
GACCAGTGGCAGCAGGCCAAGTTTGAGGGCACGTATGCCGATGCCAAGGCGCAGGCAAACCAGTTCGCCGGCTAC
AAGAGGGGCCAAAAACGAGACTGGGTGGCCGAGAAGAGCGACCTGGCCACCCTACTGGGCAACATCAAGACCAAA
CTGGGAACCTATCGTCTCCGCCCTTATGAGCCCCCGGCGGAGCTGCGGCTCGAGGTTCTGGAGCGTGACTGGAGC
ACGCTCGCACAGGTGGAGATGAAACGGGCTCAGCTCATCAACGAGACCATCCGAGACATCAAAAACGCCCTGCGA
AAGTCCTTCGCCGACAAGGCCAACGACCTGGCCATGGCCCTCAACACCATGCAGCTGGCGATATCGGGCCTCGAC
GGCGACGTCGAAGACCAGCTGCACCACGTGAGGAGGCTGAGCGACAACCTGGCACCGCTGGACCGCTACCTCGAG
ACCATCGCCGCCGTGGACGCCAAGTGTCAAGAGGCCAACATCGAGGAGAATGACTTTACGACGTACACGTACGAC
GAGCTGTCGTACGAGCTCGGCCTGGTCAAGACGTCGGTGCAGAAGAAGCTGTCCTTCCTGGAGAACCAGATGGTG
GCGCGCAACATGACGAACCTGACGCCGATCCAGCTCGAGGAGTTCGAGAGCGTCTTCCGGCACTTCGACCGGGAC
GACACCAACTCGCTGCAGGAGCTCGAGTTCAGCGCGGCGCTGGCCTCGCTCGGCCTGGTCTTCTCCGAGGACGAG
ATGCACGAGTACTTCCTGGAGACGTCCAACGGCCGCGACTACGTCACCTTTGAGCAGTTCATCCGCTTCATGGTG
GACGTGACCGAGGACCAGAACACGGCGGAGCAGGTGTTCCAGTCGTTCCGCGAGGTGGCCGACGGCAAGCCGTAC
GTGACCGAGATGGACCTGCGGCACAGCCTGGTGCCGGACGAGGTGATTGACCAGCTCGTCGAGATGATGCCCTCG
CACAAGGGGCCCGACATGTCGGCGGACCGCGGCCAGCCGCAGTACGACTACATCAGCTTCATGGAGAAGCTCATC
AACGACGAGCGGGAGGCTGAGGAGGCGCCGGCCGCGGTGCTGCAGGACCGGGTCAACGTGGGCGACACAGGGCCC
CCGCGGAGCTCGAAGCTGAACGGCACGAGTTAG
Gene >Hirsu2|4147
ATGGCGGCAGCCGCTCCAGGGGACGATGGCGCGCCCCAGCGGAGCCCATCGCTACAGCCCGGCAACGCGGAGGGA
GTCGAGCGCTTCCCCCAATTTTGTTTACAAGCCTCGAGCGCCGACGACGGACCAAAGCAGCCGCCGCAGCATCGC
AGCCACGACCATCATCACAGCACCTCTTCTGCCGCCGACGGCCCGCCCAGCAGCGTCTGCCCCGGCTCGCCCGTC
TCGTCCAAGTCGTCGCGCTCGCCGACGGCTTCGAGCGTCTCCACCGCCGCCACCAGCGTCGACTCCGACTCTCTT
CTGCCGCCCGAGGCCTCGCTCCGGCGTCGCGCCCCCACCCAGCGGAGCAGGCGGGACAAGAAGTCGCTGCATGCT
GCACGCCAGCAGCGGTCAGCAAGCGACAGGCAGCCGTTGGGCTCCAAGCCAAAGGGGTCAAAGGGGAAGCGCTTC
CAACGGAGCTCCAACAGCAGCCCGGCCGACGCCCTCGCCGCCGTTGAGCCTGCGCACGAACAGGGTCTCGCCAAG
ATGACCTTCGCCGAGCAGCAGCGCTGGATCACGGTCCAGCAGAAGACGTTTACCAAATGGTGCCTCTCTCCTCCC
TCCGCCTCCCCGGCCCCTCGTGACAGGCACTTGTCACGAGCACTTGTCACGACGGGGAGGGGAAGGGCAGAATCG
GCAAGGCTAACACCATGTCCCAGGCTAAACACCAAGCTGGTTGCCCGAGACCTCGAGGTTACGGACCTCGTCAAG
GACCTCAGCGATGGTGTAAGTCGCAGCCCCCGTCCCGTCCCGTCCCGTTCCGTCCCGTCCTGTTCCCGTTTCATC
TCATCCCGCCTCTCGCCGCAGAGCTCGAGCTGATTGGCACTGCCTTAGGTCATATTGATTCATCTTCTCGAATGC
CTGTCGAGCGAGTCACTCGGCCGCTATGCGTCGAAACCGAAGCTGCGCGTCCAACGGTTCGAAAATGCCAACCTC
GCTCTCGACTTCATCAAGTCGAGGGGCATCCAGATGACAAACATTGGCGCCGAGGATGTCGTCGACGGCAACCGC
AAGATCGTCCTGGGCCTCATCTGGACGCTGATCCTGCGCTTCACCATTAGCGAGATCAACGAGGAGGGCATCTCG
GCCAAGGAGGGCTTGCTTCTGTGGTGCCAGCGCAAGACGGCGTGCTACGACGAGGTCGAGGTCCGCGACTTCAGC
GGCAGCTGGAACGACGGCCTGGCCTTCTGCGCGCTGCTCGACATCCACCGACCCGACCTGATCGACTTTGACGCC
CTCGACAAGTCGGACCATCGCGGCAACATGCAGCTGGCCTTCGACATCGCCCACGAGGAGATTGGCATCCCCCGG
CTGCTCGACGTCGAGGACGTCTGCGACATGGCCAAGCCCGACGAGCGAAGCTTGATGACGTACATTGCATACTGG
TTCCACGCCTTTTCGCAGATGGAAAAGGTCGAAAACGCCGGCCGGCGGGTGGAAAAATTCGTCAACAACATGCAG
GGCGCCTGGGAGATGCAGAGCGCCTTTGAGCGGCGCATGCGGGAGCTGCTCAAGTCCATCAGGGGGCAGGTTGAC
CAGTGGCAGCAGGCCAAGTTTGAGGGCACGTATGCCGATGCCAAGGCGCAGGCAAACCAGTTCGCCGGCTACAAG
AGGGGCCAAAAACGAGACTGGGTGGCCGAGAAGAGCGACCTGGCCACCCTACTGGGCAACATCAAGACCAAACTG
GGAACCTATCGTCTCCGCCCTTATGAGCCCCCGGCGGAGCTGCGGCTCGAGGTTCTGGAGCGTGACTGGAGCACG
CTCGCACAGGTGGAGATGAAACGGGCTCAGCTCATCAACGAGACCATCCGAGAGTGAGTCCCACCGCTTAGGAAT
CAAGAGGCGAGAGCGAGAGCGAGAGCGAGTGAGAATGAGCTGACCGTGCCACGTGCGTCGGCAGCATCAAAAACG
CCCTGCGAAAGTCCTTCGCCGACAAGGCCAACGACCTGGCCATGGCCCTCAACACCATGCAGCTGGCGATATCGG
GCCTCGACGGCGACGTCGAAGACCAGCTGCACCACGTGAGGAGGCTGAGCGACAACCTGGCACCGCTGGACCGCT
ACCTCGAGACCATCGCCGCCGTGGACGCCAAGTGTCAAGAGGCCAACATCGAGGAGAATGACTTTACGACGTACA
CGTACGACGAGCTGTCGTACGAGCTCGGCCTGGTCAAGACGTCGGTGCAGAAGAAGCTGTCCTTCCTGGAGAACC
AGATGGTGGCGCGCAACATGACGAACCTGACGCCGATCCAGCTCGAGGAGTTCGAGAGCGTCTTCCGGCACTTCG
ACCGGGACGACACCAACTCGCTGCAGGAGCTCGAGTTCAGCGCGGCGCTGGCCTCGCTCGGCCTGGTCTTCTCCG
AGGACGAGATGCACGAGTACTTCCTGGAGACGTCCAACGGCCGCGACTACGTCACCTTTGAGCAGTTCATCCGCT
TCATGGTGGACGTGACCGAGGACCAGAACACGGCGGAGCAGGTGTTCCAGTCGTTCCGCGAGGTGGCCGACGGCA
AGCCGTACGTGACCGAGATGGACCTGCGGCACAGCCTGGTGCCGGACGAGGTGATTGACCAGCTCGTCGAGATGA
TGCCCTCGCACAAGGGGCCCGACATGTCGGCGGACCGCGGCCAGCCGCAGTACGACTACATCAGCTTCATGGAGA
AGCTCATCAACGACGAGCGGGAGGCTGAGGAGGCGCCGGCCGCGGTGCTGCAGGACCGGGTCAACGTGGGCGACA
CAGGGCCCCCGCGGAGCTCGAAGCTGAACGGCACGAGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail