Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4139
Gene name
LocationContig_2137:1560..2962
Strand-
Gene length (bp)1402
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09431 DUF2013 Protein of unknown function (DUF2013) 3.0E-47 146 287

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74771|DIP1_SCHPO Protein dip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dip1 PE=3 SV=2 100 331 2.0E-34
sp|Q12342|LDB17_YEAST Protein LDB17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDB17 PE=1 SV=1 82 323 5.0E-26
sp|Q75A44|LDB17_ASHGO Protein LDB17 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LDB17 PE=3 SV=2 98 284 3.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4139
MAENDEAVATPTGAERLWSAVSTCVSRECLTHESIDDALREWLHLTTRLRGRDSDSQDEVLLCADMLLESWLFRM
NKDYIRTQIIHSLLQEDESDPLLLLQLMYEMSRVERLKAEDLMLVEDNFIHHLFRAVEGVSDDVQDLHYFPSIRV
LLVLNEQYMLASTDSATNQDATPSSLLPLTNRVVKCLSLHGPMFRMFGENIILLLNRETETSLQLLILKLLYLLF
TTKATYEFFYTNDLRVLLDVIIRNLMDLPDEKMSLRHTYLRVMYPLLAHTQLSQPPHYKRYEVLRALRLLRGSDT
AHFAPADETTLRLVERVAKVAWLGVELIDRGQDKELSGQAEVARKMLGMSLLPFQFESSIH*
Coding >Hirsu2|4139
ATGGCCGAAAACGATGAGGCGGTTGCCACCCCTACCGGCGCTGAACGGCTATGGTCCGCAGTTAGCACCTGCGTG
TCAAGAGAATGCCTGACGCACGAGTCCATTGACGATGCGCTGCGCGAATGGTTGCATCTGACCACGAGACTTCGA
GGCCGGGACTCCGACTCTCAAGACGAAGTGCTCCTCTGCGCCGATATGCTACTGGAAAGCTGGCTTTTTCGGATG
AACAAGGATTATATACGCACTCAGATCATCCACAGCCTTCTTCAAGAGGATGAGTCAGACCCCTTGTTGCTATTA
CAGCTCATGTACGAGATGTCGAGGGTGGAACGACTGAAGGCAGAAGATCTGATGCTGGTCGAAGACAACTTCATC
CACCATCTGTTTCGGGCGGTCGAGGGCGTTTCCGACGACGTGCAAGATCTCCATTATTTTCCAAGCATTAGAGTT
CTGCTCGTTCTCAACGAGCAGTACATGCTAGCGTCAACCGACTCGGCTACGAACCAAGACGCTACCCCCTCATCG
TTGCTCCCGCTCACAAACCGTGTTGTCAAATGTCTCAGTCTCCACGGCCCAATGTTCCGCATGTTTGGCGAGAAC
ATCATCTTACTCCTGAATCGCGAGACGGAAACGTCACTTCAGCTACTGATACTAAAGCTCCTCTACCTGCTTTTC
ACCACCAAAGCCACCTATGAGTTTTTCTACACCAACGACTTGCGGGTGCTTCTGGACGTCATCATTCGGAATCTA
ATGGATTTACCCGATGAAAAGATGTCATTGCGTCACACTTACCTGAGGGTCATGTATCCGCTGCTGGCCCATACG
CAACTCAGCCAGCCGCCGCATTATAAGCGGTACGAAGTGCTGCGGGCCCTGAGGCTCCTTCGCGGCTCTGACACT
GCCCATTTTGCGCCTGCTGATGAAACGACGTTGCGTCTGGTGGAGAGAGTGGCCAAGGTCGCTTGGCTTGGGGTG
GAGCTAATAGACCGCGGGCAGGACAAGGAGCTTTCGGGGCAGGCCGAGGTGGCGCGGAAGATGCTCGGCATGAGC
CTGTTGCCGTTCCAGTTCGAAAGCAGCATCCATTGA
Transcript >Hirsu2|4139
ATGGCCGAAAACGATGAGGCGGTTGCCACCCCTACCGGCGCTGAACGGCTATGGTCCGCAGTTAGCACCTGCGTG
TCAAGAGAATGCCTGACGCACGAGTCCATTGACGATGCGCTGCGCGAATGGTTGCATCTGACCACGAGACTTCGA
GGCCGGGACTCCGACTCTCAAGACGAAGTGCTCCTCTGCGCCGATATGCTACTGGAAAGCTGGCTTTTTCGGATG
AACAAGGATTATATACGCACTCAGATCATCCACAGCCTTCTTCAAGAGGATGAGTCAGACCCCTTGTTGCTATTA
CAGCTCATGTACGAGATGTCGAGGGTGGAACGACTGAAGGCAGAAGATCTGATGCTGGTCGAAGACAACTTCATC
CACCATCTGTTTCGGGCGGTCGAGGGCGTTTCCGACGACGTGCAAGATCTCCATTATTTTCCAAGCATTAGAGTT
CTGCTCGTTCTCAACGAGCAGTACATGCTAGCGTCAACCGACTCGGCTACGAACCAAGACGCTACCCCCTCATCG
TTGCTCCCGCTCACAAACCGTGTTGTCAAATGTCTCAGTCTCCACGGCCCAATGTTCCGCATGTTTGGCGAGAAC
ATCATCTTACTCCTGAATCGCGAGACGGAAACGTCACTTCAGCTACTGATACTAAAGCTCCTCTACCTGCTTTTC
ACCACCAAAGCCACCTATGAGTTTTTCTACACCAACGACTTGCGGGTGCTTCTGGACGTCATCATTCGGAATCTA
ATGGATTTACCCGATGAAAAGATGTCATTGCGTCACACTTACCTGAGGGTCATGTATCCGCTGCTGGCCCATACG
CAACTCAGCCAGCCGCCGCATTATAAGCGGTACGAAGTGCTGCGGGCCCTGAGGCTCCTTCGCGGCTCTGACACT
GCCCATTTTGCGCCTGCTGATGAAACGACGTTGCGTCTGGTGGAGAGAGTGGCCAAGGTCGCTTGGCTTGGGGTG
GAGCTAATAGACCGCGGGCAGGACAAGGAGCTTTCGGGGCAGGCCGAGGTGGCGCGGAAGATGCTCGGCATGAGC
CTGTTGCCGTTCCAGTTCGAAAGCAGCATCCATTGA
Gene >Hirsu2|4139
ATGGCCGAAAACGATGAGGCGGTTGCCACCCCTACCGGCGCTGAACGGCTATGGTCCGGTACGTCATAGCCAGAG
CTGACTTGAGGCATTTCACAGCTAAGCTGCCCGGCAGCAGTTAGCACCTGCGTGTCAAGAGAATGCCTGACGCAC
GAGTCCATTGACGATGCGCTGCGCGAATGGTTGCATCTGACCACGAGACTTCGAGGCCGGGACTCCGACTCTCAA
GACGAAGTGCTCCTCTGCGCCGATATGCTACTGGAAAGCTGGCTTTTTCGGATGAACAAGGATTATATACGCACT
CAGATCATCCACAGCCTTCTTCAAGAGGATGAGTCAGACCCCTTGTACGCCATAGCGTATTTGCTACTTGTCGAT
GGCTGCCACGACGAGTCAACCTTCCCACGTATGATCCAAGAGTCGAGCTTCCCTCGACTTCTTGACCTCGTCAAT
CTACATCGAGATGACGACGATCTACGCCTCCATAGGTTGCTATTACAGCTCATGTACGAGATGTCGAGGGTGGAA
CGACTGAAGGCAGAAGATCTGATGCTGGTCGAAGACAACTTCATCCACCATCTGTTTCGGGCGGTCGAGGGCGTT
TCCGACGACGTGCAAGATCTCCATTATTTTCCAAGCATTAGAGTTCTGGTAAGCTTTGTAGTTCAGGCAAGCCAA
GGCTGTGTCCGCCGCTGACTCGTTGATAGCTCGTTCTCAACGAGCAGTACATGCTAGCGTCAACCGACTCGGCTA
CGAACCAAGACGCTACCCCCTCATCGTTGCTCCCGCTCACAAACCGTGTTGTCAAATGTCTCAGTCTCCACGGCC
CAATGTTCCGCATGTTTGGCGAGAACATCATCTTACTCCTGAATCGCGAGACGGAAACGTCACTTCAGCTACTGA
TACTAAAGCTCCTCTACCTGCTTTTCACCACCAAAGCCACCTATGAGTTTTTCTACACCAACGACTTGCGGGTGC
TTCTGGACGTCATCATTCGGAATCTAATGGATTTACCCGATGAAAAGATGTCATTGCGTCACACTTACCTGAGGG
TCATGTATCCGCTGCTGGCCCATACGCAACTCAGCCAGCCGCCGCATTATAAGCGGTACGAAGTGCTGCGGGCCC
TGAGGCTCCTTCGCGGCTCTGACACTGCCCATTTTGCGCCTGCTGATGAAACGACGTTGCGTCTGGTGGAGAGAG
TGGCCAAGGTCGCTTGGCTTGGGGTGGAGCTAATAGACCGCGGGCAGGACAAGGAGCTTTCGGGGCAGGCCGAGG
TGGCGCGGAAGATGCTCGGCATGAGCCTGTTGCCGTTCCAGTTCGAAAGCAGCGTGAGCGTCGGTGACGTTGCGG
GGGTCATGGAGAGGCCGGGTGTGCAGACGCCGAGTCGACACAGATCCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail