Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4131
Gene name
LocationContig_2132:1161..3540
Strand-
Gene length (bp)2379
Transcript length (bp)1869
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00641 zf-RanBP Zn-finger in Ran binding protein and others 5.2E-11 350 377
PF00641 zf-RanBP Zn-finger in Ran binding protein and others 3.9E-07 429 458
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 6.3E-08 255 322
PF00929 RNase_T Exonuclease 9.2E-07 19 127

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13801|YE04_SCHPO Uncharacterized RNA-binding protein C17H9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.04c PE=1 SV=1 13 466 4.0E-124
sp|P32770|NRP1_YEAST Asparagine-rich protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRP1 PE=1 SV=2 105 377 8.0E-79
sp|P32770|NRP1_YEAST Asparagine-rich protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRP1 PE=1 SV=2 420 459 3.0E-08
sp|Q8C460|ERI3_MOUSE ERI1 exoribonuclease 3 OS=Mus musculus GN=Eri3 PE=1 SV=1 12 149 1.0E-07

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4131
MSSQPQLNIDRYVVIHVATTCDEHGVYVTKDSAEVIELGWILLDANSLEEITHESVLVKPVNTPITPLCTSLTTL
TWEHVRNAGTFRDAISRFDTFATEYLTSKNNDFVFVTLDAWDLRVQLPREARDKAVVLPPYLQHSRTFDLRTEYQ
RWQQHHPESLPFGPSMLSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAITLARVLRGLIRKSQPP
QDHPDVLTRPMDARADVRAFLSERSKVLHMSGLPHDTTQSELESWFTQFGGRPIAFWTLRTPEQHKPTGTGFAVF
SSHEEAAESLCMNGRALNEKAIEVSPSSSRVLDRAQDILTPFPPSKNRPRPGDWTCPSCGFSNFQRRTACFRCSF
PAMGPGPAGEMGGSGGYGYNYGPPTMMPPPPHGGHHGPMGHGGRMGGGGVVPFRAGDWKCGNEVCGYHNFAKNVC
CLRCGASRAGAAVVADSGYPSPMENASQYSMSQGSMAGTPGPGPGPFGSGNSFASGGGYNQHFGGPPSHFLPSGL
GGAGTYPSSLNTQGFGAAPGTHSAGPFDSRAAEAAFQSATNGPASAGPGPSNNFYNSSNNGENDPFAFLSTGIGG
LSVGGGDARQNGGGAPPSKSPA*
Coding >Hirsu2|4131
ATGTCTTCGCAGCCGCAGCTCAACATCGACCGCTACGTCGTCATCCACGTCGCCACCACTTGCGATGAACACGGC
GTCTACGTCACCAAGGACTCGGCCGAGGTCATCGAGCTTGGCTGGATTCTCCTCGACGCCAACTCGCTTGAGGAG
ATTACCCACGAGAGTGTTCTTGTCAAGCCGGTCAACACTCCCATCACTCCGCTCTGCACAAGTCTGACGACTCTC
ACTTGGGAGCATGTTCGAAACGCCGGTACCTTTAGAGACGCTATCTCTCGATTCGACACGTTTGCTACCGAGTAT
CTGACCTCCAAGAACAACGACTTCGTCTTCGTCACCCTCGACGCATGGGACCTCCGCGTCCAGCTGCCCCGCGAG
GCACGCGACAAGGCTGTTGTGCTCCCACCCTACCTGCAGCATTCGCGCACCTTTGACTTGCGCACCGAGTATCAG
CGATGGCAGCAGCACCACCCCGAATCCCTGCCCTTCGGGCCCTCCATGCTGTCCAACATCTGCGCCGCCCTCGAG
GTCGAGCCCGTCCAGTCGAGCGCCCCGATCAAGCACAACCTGCCCTTCCACCTCCAGGCCCTTGCTCCCGCCTCG
CCGCGCCGCGCCATGGAGGAGGCCATCACCCTGGCCCGCGTCCTCCGCGGTCTCATCCGCAAGTCGCAGCCGCCA
CAGGACCACCCCGACGTCTTGACCAGGCCCATGGACGCCAGGGCCGACGTGCGCGCCTTTCTGTCCGAGAGGAGC
AAGGTGCTCCACATGTCTGGCCTCCCGCACGACACCACCCAGTCGGAGCTCGAGAGCTGGTTCACCCAGTTCGGC
GGACGACCCATCGCCTTTTGGACCCTGCGCACCCCGGAGCAGCACAAGCCGACCGGCACCGGCTTCGCCGTCTTC
TCCTCCCATGAGGAGGCCGCCGAGAGCCTCTGCATGAACGGCCGTGCGCTCAACGAAAAGGCCATCGAGGTGTCT
CCCTCGTCCAGCCGCGTCTTGGATCGCGCGCAGGATATCCTGACGCCCTTCCCCCCGAGCAAGAATCGTCCCCGG
CCCGGCGACTGGACGTGTCCCTCGTGCGGCTTCTCCAACTTTCAGCGCCGAACTGCCTGCTTCCGATGCTCTTTC
CCGGCCATGGGGCCCGGCCCCGCCGGCGAGATGGGCGGCAGCGGCGGTTACGGCTACAACTACGGCCCCCCGACC
ATGATGCCGCCTCCCCCGCACGGCGGCCACCACGGCCCCATGGGCCACGGCGGGCGCATGGGCGGCGGCGGCGTC
GTCCCTTTCCGCGCCGGCGACTGGAAGTGCGGCAACGAGGTGTGTGGCTACCACAACTTCGCCAAGAATGTGTGC
TGCCTCCGCTGCGGCGCCAGCCGCGCCGGGGCCGCCGTCGTGGCCGACTCGGGCTACCCGTCCCCGATGGAGAAC
GCGTCGCAGTACAGCATGAGCCAGGGCTCCATGGCCGGCACGCCCGGCCCGGGCCCCGGCCCCTTCGGCTCCGGC
AACTCGTTCGCGTCTGGCGGCGGCTACAACCAGCACTTCGGCGGGCCGCCCAGCCACTTCCTGCCGTCCGGCCTC
GGCGGCGCCGGGACGTATCCCAGCTCGCTCAACACGCAGGGCTTCGGAGCGGCGCCCGGCACTCACTCGGCGGGG
CCGTTCGACAGCAGGGCCGCCGAGGCCGCCTTCCAGTCGGCGACCAACGGTCCCGCGTCGGCAGGCCCCGGGCCG
TCGAACAACTTCTACAACAGCAGCAACAACGGCGAGAACGACCCGTTCGCCTTCCTGTCGACGGGCATCGGCGGC
CTCTCGGTCGGGGGCGGCGACGCTCGCCAGAACGGCGGGGGCGCGCCGCCGAGCAAGTCGCCCGCCTAA
Transcript >Hirsu2|4131
ATGTCTTCGCAGCCGCAGCTCAACATCGACCGCTACGTCGTCATCCACGTCGCCACCACTTGCGATGAACACGGC
GTCTACGTCACCAAGGACTCGGCCGAGGTCATCGAGCTTGGCTGGATTCTCCTCGACGCCAACTCGCTTGAGGAG
ATTACCCACGAGAGTGTTCTTGTCAAGCCGGTCAACACTCCCATCACTCCGCTCTGCACAAGTCTGACGACTCTC
ACTTGGGAGCATGTTCGAAACGCCGGTACCTTTAGAGACGCTATCTCTCGATTCGACACGTTTGCTACCGAGTAT
CTGACCTCCAAGAACAACGACTTCGTCTTCGTCACCCTCGACGCATGGGACCTCCGCGTCCAGCTGCCCCGCGAG
GCACGCGACAAGGCTGTTGTGCTCCCACCCTACCTGCAGCATTCGCGCACCTTTGACTTGCGCACCGAGTATCAG
CGATGGCAGCAGCACCACCCCGAATCCCTGCCCTTCGGGCCCTCCATGCTGTCCAACATCTGCGCCGCCCTCGAG
GTCGAGCCCGTCCAGTCGAGCGCCCCGATCAAGCACAACCTGCCCTTCCACCTCCAGGCCCTTGCTCCCGCCTCG
CCGCGCCGCGCCATGGAGGAGGCCATCACCCTGGCCCGCGTCCTCCGCGGTCTCATCCGCAAGTCGCAGCCGCCA
CAGGACCACCCCGACGTCTTGACCAGGCCCATGGACGCCAGGGCCGACGTGCGCGCCTTTCTGTCCGAGAGGAGC
AAGGTGCTCCACATGTCTGGCCTCCCGCACGACACCACCCAGTCGGAGCTCGAGAGCTGGTTCACCCAGTTCGGC
GGACGACCCATCGCCTTTTGGACCCTGCGCACCCCGGAGCAGCACAAGCCGACCGGCACCGGCTTCGCCGTCTTC
TCCTCCCATGAGGAGGCCGCCGAGAGCCTCTGCATGAACGGCCGTGCGCTCAACGAAAAGGCCATCGAGGTGTCT
CCCTCGTCCAGCCGCGTCTTGGATCGCGCGCAGGATATCCTGACGCCCTTCCCCCCGAGCAAGAATCGTCCCCGG
CCCGGCGACTGGACGTGTCCCTCGTGCGGCTTCTCCAACTTTCAGCGCCGAACTGCCTGCTTCCGATGCTCTTTC
CCGGCCATGGGGCCCGGCCCCGCCGGCGAGATGGGCGGCAGCGGCGGTTACGGCTACAACTACGGCCCCCCGACC
ATGATGCCGCCTCCCCCGCACGGCGGCCACCACGGCCCCATGGGCCACGGCGGGCGCATGGGCGGCGGCGGCGTC
GTCCCTTTCCGCGCCGGCGACTGGAAGTGCGGCAACGAGGTGTGTGGCTACCACAACTTCGCCAAGAATGTGTGC
TGCCTCCGCTGCGGCGCCAGCCGCGCCGGGGCCGCCGTCGTGGCCGACTCGGGCTACCCGTCCCCGATGGAGAAC
GCGTCGCAGTACAGCATGAGCCAGGGCTCCATGGCCGGCACGCCCGGCCCGGGCCCCGGCCCCTTCGGCTCCGGC
AACTCGTTCGCGTCTGGCGGCGGCTACAACCAGCACTTCGGCGGGCCGCCCAGCCACTTCCTGCCGTCCGGCCTC
GGCGGCGCCGGGACGTATCCCAGCTCGCTCAACACGCAGGGCTTCGGAGCGGCGCCCGGCACTCACTCGGCGGGG
CCGTTCGACAGCAGGGCCGCCGAGGCCGCCTTCCAGTCGGCGACCAACGGTCCCGCGTCGGCAGGCCCCGGGCCG
TCGAACAACTTCTACAACAGCAGCAACAACGGCGAGAACGACCCGTTCGCCTTCCTGTCGACGGGCATCGGCGGC
CTCTCGGTCGGGGGCGGCGACGCTCGCCAGAACGGCGGGGGCGCGCCGCCGAGCAAGTCGCCCGCCTAA
Gene >Hirsu2|4131
ATGTCTTCGCAGCCGCAGCTCAACATCGACCGCTACGTCGTCATCCACGTCGCCACCACTTGCGATGAACACGGC
GTCTACGTCACCAAGGACTCGGCCGAGGTCATCGAGCTTGGCTGGATTCTCCTCGACGCCAACTCGCTTGAGGAG
GTGAGTAGCTTGGGATCCCGCGACGCCTCACGCCACCACCAACTCCTCCCGCCGCCTCCTCCTCATCCATCTCCT
CCCCACGCTCCTCGCGTTCCTCCGCCTCGTCTTCTCCTCGCGCTCCTCCGCCTCCTCCGCCTTCTCCTCCTCCTC
TTTCCCCATCTCCTCCTCGTCCAACGTGGCCGCACCACCTCTGACCTGCTCCGCCTCAAAACGCAACAGATTACC
CACGAGAGTGTTCTTGTCAAGCCGGTCAACACTCCCATCACTCCGCTCTGCAGTAAGTCCTCCCAATTCTCCCTC
CCTCCTGTCCCGCCTGAGCTGTCCTTCTCGCCCGGCCTCTGCCCCCCAAGTGCAAACGTACCGCCGCCTCCCCCG
CCTTCACGCCGTGCAAACGCACCAACTCGCTTGAGCGGCCATGTCTTCACGCGTGCCGGAATCGGGCTTACCATC
ATGTCTCCTTAGCAAGTCTGACGACTCTCACTTGGGAGCATGTTCGAAACGCCGGTACCTTTAGAGACGCTATCT
CTCGATTCGACACGTTTGCTACCGAGTATCTGACCTCCAAGAACAACGACTTCGTCTTCGTCACCCTCGACGCAT
GGGACCTCCGCGTCCAGCTGCCCCGCGAGGCACGCGACAAGGCTGTTGTGCTCCCACCCTACCTGCAGCATTCGC
GCACCTTTGACTTGCGCACCGAGTATCAGCGATGGCAGCAGCACCACCCCGAATCCCTGCCCTTCGGGCCCTCCA
TGCTGTCCAACATCTGCGCCGCCCTCGAGGTCGAGCCCGTCCAGTCGAGCGCCCCGATCAAGCACAACCTGCCCT
TCCACCTCCAGGCCCTTGCTCCCGCCTCGCCGCGCCGCGCCATGGAGGAGGCCATCACCCTGGCCCGCGTCCTCC
GCGGTCTCATCCGCAAGTCGCAGCCGCCACAGGACCACCCCGACGTCTTGACCAGGCCCATGGACGCCAGGGCCG
ACGTGCGCGCCTTTCTGTCCGAGAGGAGCAAGGTGCTCCACATGTCTGGCCTCCCGCACGACACCACCCAGTCGG
AGCTCGAGAGCTGGTTCACCCAGTTCGGCGGACGACCCATCGCCTTTTGGACCCTGCGCACCCCGGAGCAGCACA
AGCCGACCGGCACCGGCTTCGCCGTCTTCTCCTCCCATGAGGAGGTAAGTCGCACCTCCTTCACGCTCCATCTGC
AAACTTTGCCCGTCCCGGCCCTCGCAGCCGCCGGGCCAGCTCTGCGGGATGAACGGATGCTGACCAGACAAACAG
GCCGCCGAGAGCCTCTGCATGAACGGCCGTGCGCTCAACGAAAAGGCCATCGAGGTGTCTCCCTCGTCCAGCCGC
GTCTTGGATCGCGCGCAGGATATCCTGACGCCCTTCCCCCCGAGCAAGAATCGTCCCCGGCCCGGCGACTGGACG
TGTCCCTCGTGCGGCTTCTCCAACTTTCAGCGCCGAACTGCCTGCTTCCGATGCTCTTTCCCGGCCATGGGGCCC
GGCCCCGCCGGCGAGATGGGCGGCAGCGGCGGTTACGGCTACAACTACGGCCCCCCGACCATGATGCCGCCTCCC
CCGCACGGCGGCCACCACGGCCCCATGGGCCACGGCGGGCGCATGGGCGGCGGCGGCGTCGTCCCTTTCCGCGCC
GGCGACTGGAAGTGCGGCAACGAGGTGTGTGGCTACCACAACTTCGCCAAGAATGTGTGCTGCCTCCGCTGCGGC
GCCAGCCGCGCCGGGGCCGCCGTCGTGGCCGACTCGGGCTACCCGTCCCCGATGGAGAACGCGTCGCAGTACAGC
ATGAGCCAGGGCTCCATGGCCGGCACGCCCGGCCCGGGCCCCGGCCCCTTCGGCTCCGGCAACTCGTTCGCGTCT
GGCGGCGGCTACAACCAGCACTTCGGCGGGCCGCCCAGCCACTTCCTGCCGTCCGGCCTCGGCGGCGCCGGGACG
TATCCCAGCTCGCTCAACACGCAGGGCTTCGGAGCGGCGCCCGGCACTCACTCGGCGGGGCCGTTCGACAGCAGG
GCCGCCGAGGCCGCCTTCCAGTCGGCGACCAACGGTCCCGCGTCGGCAGGCCCCGGGCCGTCGAACAACTTCTAC
AACAGCAGCAACAACGGCGAGAACGACCCGTTCGCCTTCCTGTCGACGGGCATCGGCGGCCTCTCGGTCGGGGGC
GGCGACGCTCGCCAGAACGGCGGGGGCGCGCCGCCGAGCAAGTCGCCCGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail