Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4130
Gene name
LocationContig_2131:2600..3128
Strand-
Gene length (bp)528
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01284 MARVEL Membrane-associating domain 2.7E-21 4 148

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12207|NCE2_YEAST Non-classical export protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCE102 PE=1 SV=1 1 174 1.0E-10
sp|Q5ANE3|NCE2_CANAL Non-classical export protein 102 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCE102 PE=1 SV=1 6 174 7.0E-06

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 7 28 21
2 43 65 22
3 72 94 22
4 136 158 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4130
MHSWVNLVVRLICLMWTLIITALIGNVVDQNINGASSAMAALDWVLFVCAWSWLACFYSIAATYVDALANPFITI
PIDFFAWLFTIIAGVVLAAKLTGVNCGNWEHRNFGRGWIAFGSHNTEKRCREIQASTVMMWFLWVCFCVGFFLTC
LQAKGAIGGFGRSSRRSRPNMSQVA*
Coding >Hirsu2|4130
ATGCATTCGTGGGTCAACCTCGTCGTCCGGCTCATCTGCCTGATGTGGACGCTCATCATCACGGCCCTGATCGGC
AACGTCGTCGACCAGAACATCAACGGTGCCAGCAGCGCCATGGCCGCGCTCGACTGGGTCCTCTTCGTCTGCGCC
TGGTCTTGGCTGGCCTGCTTCTACTCCATCGCCGCCACCTACGTCGACGCGCTGGCCAACCCCTTCATCACCATC
CCCATCGACTTCTTCGCCTGGCTCTTCACCATCATCGCCGGCGTCGTCCTGGCCGCCAAGCTGACGGGCGTCAAC
TGCGGCAACTGGGAGCACCGCAACTTCGGCCGCGGCTGGATCGCCTTCGGCTCCCACAACACCGAGAAGCGCTGT
CGCGAGATCCAGGCCAGCACCGTCATGATGTGGTTCCTCTGGGTCTGCTTCTGCGTCGGCTTCTTCCTCACCTGC
CTGCAGGCCAAGGGCGCCATCGGCGGCTTCGGTCGCTCTTCGCGCCGCTCCCGCCCCAACATGTCGCAGGTCGCC
TAA
Transcript >Hirsu2|4130
ATGCATTCGTGGGTCAACCTCGTCGTCCGGCTCATCTGCCTGATGTGGACGCTCATCATCACGGCCCTGATCGGC
AACGTCGTCGACCAGAACATCAACGGTGCCAGCAGCGCCATGGCCGCGCTCGACTGGGTCCTCTTCGTCTGCGCC
TGGTCTTGGCTGGCCTGCTTCTACTCCATCGCCGCCACCTACGTCGACGCGCTGGCCAACCCCTTCATCACCATC
CCCATCGACTTCTTCGCCTGGCTCTTCACCATCATCGCCGGCGTCGTCCTGGCCGCCAAGCTGACGGGCGTCAAC
TGCGGCAACTGGGAGCACCGCAACTTCGGCCGCGGCTGGATCGCCTTCGGCTCCCACAACACCGAGAAGCGCTGT
CGCGAGATCCAGGCCAGCACCGTCATGATGTGGTTCCTCTGGGTCTGCTTCTGCGTCGGCTTCTTCCTCACCTGC
CTGCAGGCCAAGGGCGCCATCGGCGGCTTCGGTCGCTCTTCGCGCCGCTCCCGCCCCAACATGTCGCAGGTCGCC
TAA
Gene >Hirsu2|4130
ATGCATTCGTGGGTCAACCTCGTCGTCCGGCTCATCTGCCTGATGTGGACGCTCATCATCACGGCCCTGATCGGC
AACGTCGTCGACCAGAACATCAACGGTGCCAGCAGCGCCATGGCCGCGCTCGACTGGGTCCTCTTCGTCTGCGCC
TGGTCTTGGCTGGCCTGCTTCTACTCCATCGCCGCCACCTACGTCGACGCGCTGGCCAACCCCTTCATCACCATC
CCCATCGACTTCTTCGCCTGGCTCTTCACCATCATCGCCGGCGTCGTCCTGGCCGCCAAGCTGACGGGCGTCAAC
TGCGGCAACTGGGAGCACCGCAACTTCGGCCGCGGCTGGATCGCCTTCGGCTCCCACAACACCGAGAAGCGCTGT
CGCGAGATCCAGGCCAGCACCGTCATGATGTGGTTCCTCTGGGTCTGCTTCTGCGTCGGCTTCTTCCTCACCTGC
CTGCAGGCCAAGGGCGCCATCGGCGGCTTCGGTCGCTCTTCGCGCCGCTCCCGCCCCAACATGTCGCAGGTCGCC
TAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail