Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4115
Gene name
LocationContig_2125:2530..3607
Strand-
Gene length (bp)1077
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 1 341 6.0E-63
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 9 307 5.0E-29
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 8 306 2.0E-24
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 1 332 4.0E-24
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 1 315 4.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 1 341 6.0E-63
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 9 307 5.0E-29
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 8 306 2.0E-24
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 1 332 4.0E-24
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 1 315 4.0E-24
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 3 283 2.0E-20
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 7 324 1.0E-19
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 1 357 1.0E-17
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 1 357 5.0E-17
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 7 314 6.0E-15
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 6 342 4.0E-12
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 7 304 6.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 13 30 17
2 43 65 22
3 78 100 22
4 115 137 22
5 175 194 19
6 209 231 22
7 282 304 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4115
LREGLVDIDIVGLVILGAAFTLILLPFTLARNSEGGWANPRMVAMLVVGFALLPAFVLFEVYLAPRPLMTRRILR
NRSFLSAVTIFTFSQMASSVRNTYFSSYIYIIKQWSTYEWTIFLGITTMGLCVMGPIVGLIQRSTHRYKSMMVFG
AAGRLVGYGLLVRADGTMVQDTARLVVAQLVYCLGSFTVVGARVGSQASVPHEDMASIIALLTLWSTLGSSVGNA
VASAVWTNEMLDRMRAELPGVKEATILKLYGSIKKLRTGYAFDDPVRQGAIRAYAQVNGHIAVAALVLAAVPLVA
TLFMPDYYLGRQQNAVTNTGLDGERVDVPRHDDDAAAHEPKSPPFYRRWIAAYRKDRM*
Coding >Hirsu2|4115
CTGCGCGAGGGCCTGGTCGACATCGACATCGTCGGCCTCGTCATCCTCGGCGCCGCCTTCACCCTCATCCTGCTG
CCCTTCACGCTGGCCCGCAACAGCGAGGGCGGCTGGGCCAACCCGCGCATGGTGGCCATGCTCGTCGTCGGCTTC
GCCCTGCTGCCCGCCTTCGTCCTCTTCGAGGTCTACCTGGCGCCGCGCCCGCTGATGACGCGCCGCATCCTGCGC
AACCGCAGCTTCCTCTCCGCCGTCACCATCTTCACCTTTAGCCAGATGGCCTCGTCCGTCCGCAACACCTACTTC
TCCTCGTACATCTACATCATCAAGCAGTGGTCGACGTACGAGTGGACCATCTTCCTCGGCATCACCACCATGGGC
CTCTGCGTCATGGGGCCCATCGTCGGCCTGATCCAGCGCAGCACCCACCGCTACAAGTCCATGATGGTGTTCGGC
GCCGCCGGCCGCCTCGTCGGCTACGGCCTGCTGGTGCGCGCCGACGGCACCATGGTCCAGGACACGGCCCGCCTG
GTCGTCGCCCAGCTGGTCTACTGCCTCGGCTCCTTCACCGTCGTCGGCGCCCGCGTCGGCAGCCAGGCCTCGGTG
CCGCACGAGGACATGGCCTCCATCATCGCCCTGCTGACGCTGTGGTCCACGCTCGGCTCCTCCGTCGGCAACGCC
GTCGCCTCGGCCGTCTGGACCAACGAGATGCTCGACCGCATGCGCGCCGAGCTGCCGGGCGTCAAGGAGGCCACC
ATCCTCAAGCTGTACGGCAGCATCAAGAAGCTGCGCACCGGCTACGCCTTCGACGACCCCGTCCGCCAGGGCGCC
ATCCGCGCCTACGCCCAGGTCAACGGCCACATCGCCGTCGCCGCCCTCGTCCTGGCCGCCGTGCCCCTGGTCGCC
ACCCTCTTCATGCCCGACTACTACCTCGGCCGCCAGCAGAACGCGGTGACCAACACGGGCCTCGACGGCGAGCGC
GTCGACGTCCCGCGCCACGACGACGACGCCGCCGCACACGAGCCCAAGTCGCCGCCCTTCTACCGCCGCTGGATC
GCAGCCTACCGCAAGGACCGGATGTAA
Transcript >Hirsu2|4115
CTGCGCGAGGGCCTGGTCGACATCGACATCGTCGGCCTCGTCATCCTCGGCGCCGCCTTCACCCTCATCCTGCTG
CCCTTCACGCTGGCCCGCAACAGCGAGGGCGGCTGGGCCAACCCGCGCATGGTGGCCATGCTCGTCGTCGGCTTC
GCCCTGCTGCCCGCCTTCGTCCTCTTCGAGGTCTACCTGGCGCCGCGCCCGCTGATGACGCGCCGCATCCTGCGC
AACCGCAGCTTCCTCTCCGCCGTCACCATCTTCACCTTTAGCCAGATGGCCTCGTCCGTCCGCAACACCTACTTC
TCCTCGTACATCTACATCATCAAGCAGTGGTCGACGTACGAGTGGACCATCTTCCTCGGCATCACCACCATGGGC
CTCTGCGTCATGGGGCCCATCGTCGGCCTGATCCAGCGCAGCACCCACCGCTACAAGTCCATGATGGTGTTCGGC
GCCGCCGGCCGCCTCGTCGGCTACGGCCTGCTGGTGCGCGCCGACGGCACCATGGTCCAGGACACGGCCCGCCTG
GTCGTCGCCCAGCTGGTCTACTGCCTCGGCTCCTTCACCGTCGTCGGCGCCCGCGTCGGCAGCCAGGCCTCGGTG
CCGCACGAGGACATGGCCTCCATCATCGCCCTGCTGACGCTGTGGTCCACGCTCGGCTCCTCCGTCGGCAACGCC
GTCGCCTCGGCCGTCTGGACCAACGAGATGCTCGACCGCATGCGCGCCGAGCTGCCGGGCGTCAAGGAGGCCACC
ATCCTCAAGCTGTACGGCAGCATCAAGAAGCTGCGCACCGGCTACGCCTTCGACGACCCCGTCCGCCAGGGCGCC
ATCCGCGCCTACGCCCAGGTCAACGGCCACATCGCCGTCGCCGCCCTCGTCCTGGCCGCCGTGCCCCTGGTCGCC
ACCCTCTTCATGCCCGACTACTACCTCGGCCGCCAGCAGAACGCGGTGACCAACACGGGCCTCGACGGCGAGCGC
GTCGACGTCCCGCGCCACGACGACGACGCCGCCGCACACGAGCCCAAGTCGCCGCCCTTCTACCGCCGCTGGATC
GCAGCCTACCGCAAGGACCGGATGTAA
Gene >Hirsu2|4115
CTGCGCGAGGGCCTGGTCGACATCGACATCGTCGGCCTCGTCATCCTCGGCGCCGCCTTCACCCTCATCCTGCTG
CCCTTCACGCTGGCCCGCAACAGCGAGGGCGGCTGGGCCAACCCGCGCATGGTGGCCATGCTCGTCGTCGGCTTC
GCCCTGCTGCCCGCCTTCGTCCTCTTCGAGGTCTACCTGGCGCCGCGCCCGCTGATGACGCGCCGCATCCTGCGC
AACCGCAGCTTCCTCTCCGCCGTCACCATCTTCACCTTTAGCCAGATGGCCTCGTCCGTCCGCAACACCTACTTC
TCCTCGTACATCTACATCATCAAGCAGTGGTCGACGTACGAGTGGACCATCTTCCTCGGCATCACCACCATGGGC
CTCTGCGTCATGGGGCCCATCGTCGGCCTGATCCAGCGCAGCACCCACCGCTACAAGTCCATGATGGTGTTCGGC
GCCGCCGGCCGCCTCGTCGGCTACGGCCTGCTGGTGCGCGCCGACGGCACCATGGTCCAGGACACGGCCCGCCTG
GTCGTCGCCCAGCTGGTCTACTGCCTCGGCTCCTTCACCGTCGTCGGCGCCCGCGTCGGCAGCCAGGCCTCGGTG
CCGCACGAGGACATGGCCTCCATCATCGCCCTGCTGACGCTGTGGTCCACGCTCGGCTCCTCCGTCGGCAACGCC
GTCGCCTCGGCCGTCTGGACCAACGAGATGCTCGACCGCATGCGCGCCGAGCTGCCGGGCGTCAAGGAGGCCACC
ATCCTCAAGCTGTACGGCAGCATCAAGAAGCTGCGCACCGGCTACGCCTTCGACGACCCCGTCCGCCAGGGCGCC
ATCCGCGCCTACGCCCAGGTCAACGGCCACATCGCCGTCGCCGCCCTCGTCCTGGCCGCCGTGCCCCTGGTCGCC
ACCCTCTTCATGCCCGACTACTACCTCGGCCGCCAGCAGAACGCGGTGACCAACACGGGCCTCGACGGCGAGCGC
GTCGACGTCCCGCGCCACGACGACGACGCCGCCGCACACGAGCCCAAGTCGCCGCCCTTCTACCGCCGCTGGATC
GCAGCCTACCGCAAGGACCGGATGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail