Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|411
Gene name
LocationContig_1080:4274..5663
Strand+
Gene length (bp)1389
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.1E-26 12 231
PF07714 Pkinase_Tyr Protein tyrosine kinase 9.6E-14 14 239
PF17667 Pkinase_fungal Fungal protein kinase 6.5E-09 123 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40235|HHP1_SCHPO Casein kinase I homolog hhp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhp1 PE=2 SV=1 4 295 0.0E+00
sp|Q9JMK2|KC1E_MOUSE Casein kinase I isoform epsilon OS=Mus musculus GN=Csnk1e PE=1 SV=2 4 342 2.0E-180
sp|P49674|KC1E_HUMAN Casein kinase I isoform epsilon OS=Homo sapiens GN=CSNK1E PE=1 SV=1 4 342 4.0E-180
sp|Q5ZLL1|KC1E_CHICK Casein kinase I isoform epsilon OS=Gallus gallus GN=CSNK1E PE=2 SV=2 4 342 5.0E-180
sp|Q06486|KC1D_RAT Casein kinase I isoform delta OS=Rattus norvegicus GN=Csnk1d PE=1 SV=2 4 298 2.0E-179
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40235|HHP1_SCHPO Casein kinase I homolog hhp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhp1 PE=2 SV=1 4 295 0.0E+00
sp|Q9JMK2|KC1E_MOUSE Casein kinase I isoform epsilon OS=Mus musculus GN=Csnk1e PE=1 SV=2 4 342 2.0E-180
sp|P49674|KC1E_HUMAN Casein kinase I isoform epsilon OS=Homo sapiens GN=CSNK1E PE=1 SV=1 4 342 4.0E-180
sp|Q5ZLL1|KC1E_CHICK Casein kinase I isoform epsilon OS=Gallus gallus GN=CSNK1E PE=2 SV=2 4 342 5.0E-180
sp|Q06486|KC1D_RAT Casein kinase I isoform delta OS=Rattus norvegicus GN=Csnk1d PE=1 SV=2 4 298 2.0E-179
sp|Q9DC28|KC1D_MOUSE Casein kinase I isoform delta OS=Mus musculus GN=Csnk1d PE=1 SV=2 4 298 2.0E-179
sp|P48730|KC1D_HUMAN Casein kinase I isoform delta OS=Homo sapiens GN=CSNK1D PE=1 SV=2 4 298 2.0E-179
sp|P35508|KC1D_BOVIN Casein kinase I isoform delta OS=Bos taurus GN=CSNK1D PE=2 SV=2 4 298 2.0E-179
sp|Q6P3K7|KC1DB_DANRE Casein kinase I isoform delta-B OS=Danio rerio GN=csnk1db PE=2 SV=1 4 361 7.0E-179
sp|Q6P647|KC1D_XENTR Casein kinase I isoform delta OS=Xenopus tropicalis GN=csnk1d PE=2 SV=1 4 301 1.0E-178
sp|Q5BP74|KC1D_XENLA Casein kinase I isoform delta OS=Xenopus laevis GN=csnk1d PE=1 SV=2 4 298 2.0E-178
sp|Q7T2E3|KC1DA_DANRE Casein kinase I isoform delta-A OS=Danio rerio GN=csnk1da PE=2 SV=1 4 298 2.0E-178
sp|Q5RC72|KC1D_PONAB Casein kinase I isoform delta OS=Pongo abelii GN=CSNK1D PE=2 SV=1 4 298 2.0E-177
sp|P42158|KC1D_ARATH Casein kinase I isoform delta-like OS=Arabidopsis thaliana GN=At4g26100 PE=2 SV=2 4 314 1.0E-175
sp|Q6QNM1|KC1_TOXGO Casein kinase I OS=Toxoplasma gondii PE=2 SV=1 4 318 3.0E-171
sp|Q8BK63|KC1A_MOUSE Casein kinase I isoform alpha OS=Mus musculus GN=Csnk1a1 PE=1 SV=2 8 311 4.0E-167
sp|P48729|KC1A_HUMAN Casein kinase I isoform alpha OS=Homo sapiens GN=CSNK1A1 PE=1 SV=2 8 311 4.0E-167
sp|P67963|KC1A_XENLA Casein kinase I isoform alpha OS=Xenopus laevis GN=csnk1a1 PE=2 SV=1 8 311 4.0E-167
sp|P67962|KC1A_CHICK Casein kinase I isoform alpha OS=Gallus gallus GN=CSNK1A1 PE=2 SV=1 8 311 4.0E-167
sp|P67829|KC1A_SHEEP Casein kinase I isoform alpha OS=Ovis aries GN=CSNK1A1 PE=3 SV=1 8 311 8.0E-167
sp|P67828|KC1A_RABIT Casein kinase I isoform alpha OS=Oryctolagus cuniculus GN=CSNK1A1 PE=1 SV=1 8 311 8.0E-167
sp|P67827|KC1A_BOVIN Casein kinase I isoform alpha OS=Bos taurus GN=CSNK1A1 PE=1 SV=1 8 311 8.0E-167
sp|Q6QNL9|KC1_EIMTE Casein kinase I OS=Eimeria tenella PE=2 SV=1 4 294 1.0E-166
sp|P40236|HHP2_SCHPO Casein kinase I homolog hhp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hhp2 PE=2 SV=2 1 300 3.0E-166
sp|P97633|KC1A_RAT Casein kinase I isoform alpha OS=Rattus norvegicus GN=Csnk1a1 PE=2 SV=1 8 311 1.0E-165
sp|O76324|DCO_DROME Discs overgrown protein kinase OS=Drosophila melanogaster GN=dco PE=1 SV=2 4 308 1.0E-164
sp|P29295|HRR25_YEAST Casein kinase I homolog HRR25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRR25 PE=1 SV=1 4 300 9.0E-164
sp|P42168|KC1A_CAEEL Casein kinase I isoform alpha OS=Caenorhabditis elegans GN=kin-19 PE=3 SV=1 1 339 5.0E-163
sp|Q556Y4|KC1_DICDI Casein kinase I OS=Dictyostelium discoideum GN=cak1-1 PE=1 SV=1 4 313 4.0E-162
sp|Q8IHZ9|KC1_PLAF7 Casein kinase I OS=Plasmodium falciparum (isolate 3D7) GN=CK1 PE=3 SV=1 4 324 2.0E-159
sp|Q7RBX5|KC1_PLAYO Casein kinase I OS=Plasmodium yoelii yoelii GN=CK1 PE=3 SV=1 4 324 4.0E-159
sp|O15726|KC1_PLAF4 Casein kinase I OS=Plasmodium falciparum (isolate Dd2) GN=CK1 PE=2 SV=1 4 326 6.0E-157
sp|Q20471|KIN20_CAEEL Casein kinase I isoform delta OS=Caenorhabditis elegans GN=kin-20 PE=2 SV=3 4 298 9.0E-157
sp|Q8N752|KC1AL_HUMAN Casein kinase I isoform alpha-like OS=Homo sapiens GN=CSNK1A1L PE=2 SV=2 5 309 2.0E-155
sp|P54367|KC1A_DROME Casein kinase I isoform alpha OS=Drosophila melanogaster GN=CkIalpha PE=1 SV=1 5 314 4.0E-155
sp|P35507|KC1B_BOVIN Casein kinase I isoform beta OS=Bos taurus GN=CSNK1B PE=2 SV=1 5 311 4.0E-137
sp|Q62763|KC1G3_RAT Casein kinase I isoform gamma-3 OS=Rattus norvegicus GN=Csnk1g3 PE=1 SV=1 6 370 1.0E-125
sp|P78368|KC1G2_HUMAN Casein kinase I isoform gamma-2 OS=Homo sapiens GN=CSNK1G2 PE=1 SV=1 6 340 5.0E-125
sp|Q5R4V3|KC1G3_PONAB Casein kinase I isoform gamma-3 OS=Pongo abelii GN=CSNK1G3 PE=2 SV=1 6 370 7.0E-125
sp|Q8C4X2|KC1G3_MOUSE Casein kinase I isoform gamma-3 OS=Mus musculus GN=Csnk1g3 PE=1 SV=2 6 340 1.0E-124
sp|Q62762|KC1G2_RAT Casein kinase I isoform gamma-2 OS=Rattus norvegicus GN=Csnk1g2 PE=2 SV=2 6 293 5.0E-124
sp|Q8BVP5|KC1G2_MOUSE Casein kinase I isoform gamma-2 OS=Mus musculus GN=Csnk1g2 PE=1 SV=1 6 293 5.0E-124
sp|Q9Y6M4|KC1G3_HUMAN Casein kinase I isoform gamma-3 OS=Homo sapiens GN=CSNK1G3 PE=1 SV=2 6 370 6.0E-124
sp|Q5PRD4|KC1G1_DANRE Casein kinase I isoform gamma-1 OS=Danio rerio GN=csnk1g1 PE=2 SV=1 6 294 3.0E-123
sp|A7E3X2|KC1G1_BOVIN Casein kinase I isoform gamma-1 OS=Bos taurus GN=CSNK1G1 PE=2 SV=1 6 294 6.0E-123
sp|Q8BTH8|KC1G1_MOUSE Casein kinase I isoform gamma-1 OS=Mus musculus GN=Csnk1g1 PE=1 SV=2 6 293 2.0E-122
sp|Q4R9A9|KC1G1_MACFA Casein kinase I isoform gamma-1 OS=Macaca fascicularis GN=CSNK1G1 PE=2 SV=1 6 294 3.0E-122
sp|Q62761|KC1G1_RAT Casein kinase I isoform gamma-1 OS=Rattus norvegicus GN=Csnk1g1 PE=2 SV=1 6 294 4.0E-122
sp|Q9HCP0|KC1G1_HUMAN Casein kinase I isoform gamma-1 OS=Homo sapiens GN=CSNK1G1 PE=1 SV=1 6 294 8.0E-122
sp|Q5ZJS0|KC1G1_CHICK Casein kinase I isoform gamma-1 OS=Gallus gallus GN=CSNK1G1 PE=2 SV=1 6 294 7.0E-121
sp|Q6NRT0|KC1G1_XENLA Casein kinase I isoform gamma-1 OS=Xenopus laevis GN=csnk1g1 PE=1 SV=1 6 294 3.0E-120
sp|P40233|CKI1_SCHPO Casein kinase I homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki1 PE=1 SV=2 1 345 3.0E-119
sp|P40234|CKI2_SCHPO Casein kinase I homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki2 PE=1 SV=2 1 295 2.0E-117
sp|O74135|CKI3_SCHPO Casein kinase I homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki3 PE=3 SV=1 8 307 3.0E-116
sp|Q8WQ99|KC1G_CAEEL Casein kinase I gamma OS=Caenorhabditis elegans GN=csnk-1 PE=3 SV=1 6 294 5.0E-112
sp|P35509|KC1G3_BOVIN Casein kinase I isoform gamma-3 (Fragment) OS=Bos taurus GN=CSNK1G3 PE=2 SV=1 6 258 3.0E-106
sp|P23291|KC11_YEAST Casein kinase I homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK1 PE=1 SV=1 8 324 2.0E-103
sp|P23292|KC12_YEAST Casein kinase I homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK2 PE=1 SV=1 8 326 4.0E-103
sp|P40230|RAG8_KLULA Casein kinase I homolog RAG8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG8 PE=3 SV=2 8 293 4.0E-101
sp|P39962|KC13_YEAST Casein kinase I homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCK3 PE=1 SV=2 8 342 1.0E-93
sp|Q8SS96|KC11_ENCCU Probable casein kinase I homolog ECU03_0910 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU03_0910 PE=3 SV=2 13 295 5.0E-91
sp|O19175|KC1A_PIG Casein kinase I isoform alpha (Fragment) OS=Sus scrofa GN=CSNK1A1 PE=2 SV=1 35 159 4.0E-64
sp|Q54DF7|Y2354_DICDI Probable serine/threonine-protein kinase DDB_G0292354 OS=Dictyostelium discoideum GN=DDB_G0292354 PE=3 SV=1 8 295 2.0E-55
sp|Q6PCN3|TTBK1_MOUSE Tau-tubulin kinase 1 OS=Mus musculus GN=Ttbk1 PE=1 SV=3 8 323 2.0E-42
sp|Q5TCY1|TTBK1_HUMAN Tau-tubulin kinase 1 OS=Homo sapiens GN=TTBK1 PE=1 SV=2 8 323 3.0E-42
sp|Q6IQ55|TTBK2_HUMAN Tau-tubulin kinase 2 OS=Homo sapiens GN=TTBK2 PE=1 SV=2 1 293 2.0E-41
sp|Q8SQR2|KC12_ENCCU Probable casein kinase I homolog ECU11_1980 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1980 PE=3 SV=1 12 280 5.0E-41
sp|Q3UVR3|TTBK2_MOUSE Tau-tubulin kinase 2 OS=Mus musculus GN=Ttbk2 PE=1 SV=1 1 293 6.0E-41
sp|P81123|KC1D_RABIT Casein kinase I isoform delta (Fragment) OS=Oryctolagus cuniculus GN=CSNK1D PE=1 SV=1 132 209 2.0E-40
sp|Q95PZ9|SPE6_CAEEL Probable serine/threonine-protein kinase spe-6 OS=Caenorhabditis elegans GN=spe-6 PE=1 SV=1 10 293 3.0E-32
sp|Q80X41|VRK1_MOUSE Serine/threonine-protein kinase VRK1 OS=Mus musculus GN=Vrk1 PE=1 SV=2 11 330 1.0E-28
sp|Q32PI1|VRK1_BOVIN Serine/threonine-protein kinase VRK1 OS=Bos taurus GN=VRK1 PE=2 SV=1 11 351 2.0E-28
sp|Q86Y07|VRK2_HUMAN Serine/threonine-protein kinase VRK2 OS=Homo sapiens GN=VRK2 PE=1 SV=3 3 276 2.0E-28
sp|Q8BN21|VRK2_MOUSE Serine/threonine-protein kinase VRK2 OS=Mus musculus GN=Vrk2 PE=1 SV=2 4 276 5.0E-28
sp|Q99986|VRK1_HUMAN Serine/threonine-protein kinase VRK1 OS=Homo sapiens GN=VRK1 PE=1 SV=1 11 276 6.0E-28
sp|Q7ZUS1|VRK1_DANRE Serine/threonine-protein kinase VRK1 OS=Danio rerio GN=vrk1 PE=2 SV=1 11 345 2.0E-26
sp|Q9J523|V212_FOWPN Probable serine/threonine-protein kinase FPV212 OS=Fowlpox virus (strain NVSL) GN=FPV212 PE=3 SV=1 2 276 2.0E-25
sp|P34516|YMX8_CAEEL Putative serine/threonine-protein kinase K06H7.1 OS=Caenorhabditis elegans GN=K06H7.8 PE=3 SV=2 8 344 2.0E-23
sp|P16913|VPK1_VACCW Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Western Reserve) GN=VPK1 PE=1 SV=1 10 276 1.0E-22
sp|O57252|VPK1_VACCA Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Ankara) GN=VPK1 PE=3 SV=1 10 276 1.0E-22
sp|P33800|VPK1_VAR67 Serine/threonine-protein kinase 1 OS=Variola virus (isolate Human/India/Ind3/1967) GN=B1R PE=3 SV=1 10 276 2.0E-22
sp|P20505|VPK1_VACCC Serine/threonine-protein kinase 1 OS=Vaccinia virus (strain Copenhagen) GN=VPK1 PE=2 SV=1 10 276 2.0E-22
sp|Q91FD5|389L_IIV6 Probable serine/threonine-protein kinase 389L OS=Invertebrate iridescent virus 6 GN=IIV6-389L PE=3 SV=1 8 276 3.0E-21
sp|Q09503|YQI1_CAEEL Uncharacterized protein C45G9.1 OS=Caenorhabditis elegans GN=C45G9.1 PE=3 SV=2 68 293 4.0E-21
sp|P42169|YKL2_CAEEL Putative casein kinase I C03C10.2 OS=Caenorhabditis elegans GN=C03C10.2 PE=3 SV=2 10 232 6.0E-21
sp|P34633|YOO1_CAEEL Putative serine/threonine-protein kinase ZK507.1 OS=Caenorhabditis elegans GN=ZK507.1 PE=3 SV=3 74 278 3.0E-20
sp|Q7KRY6|NHK1_DROME Nucleosomal histone kinase 1 OS=Drosophila melanogaster GN=ball PE=1 SV=1 5 276 2.0E-19
sp|P54736|PKN2_MYXXA Serine/threonine-protein kinase pkn2 OS=Myxococcus xanthus GN=pkn2 PE=3 SV=1 6 218 2.0E-17
sp|P24362|KRB2_VACCW Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Western Reserve) GN=VACWR194 PE=2 SV=1 66 276 6.0E-17
sp|P21098|KRB2_VACCC Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Copenhagen) GN=B12R PE=3 SV=1 66 276 1.0E-16
sp|O57259|KRB2_VACCA Probable serine/threonine-protein kinase B12 OS=Vaccinia virus (strain Ankara) GN=MVA180R PE=3 SV=1 66 276 3.0E-16
sp|Q2YDN8|VRK3_BOVIN Inactive serine/threonine-protein kinase VRK3 OS=Bos taurus GN=VRK3 PE=2 SV=1 66 280 6.0E-16
sp|P34635|YOO3_CAEEL Putative serine/threonine-protein kinase ZK507.3 OS=Caenorhabditis elegans GN=ZK507.3 PE=3 SV=3 12 278 7.0E-16
sp|Q9J509|V226_FOWPN Probable serine/threonine-protein kinase FPV226 OS=Fowlpox virus (strain NVSL) GN=FPV226 PE=3 SV=1 9 279 1.0E-15
sp|Q8K3G5|VRK3_MOUSE Inactive serine/threonine-protein kinase VRK3 OS=Mus musculus GN=Vrk3 PE=1 SV=2 66 280 2.0E-15
sp|Q8IV63|VRK3_HUMAN Inactive serine/threonine-protein kinase VRK3 OS=Homo sapiens GN=VRK3 PE=1 SV=2 66 281 9.0E-15
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 8 227 2.0E-14
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 7 228 2.0E-13
sp|P33973|PKN1_MYXXA Serine/threonine-protein kinase Pkn1 OS=Myxococcus xanthus GN=pkn1 PE=1 SV=1 4 221 2.0E-13
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 3 216 2.0E-13
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 11 216 2.0E-13
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 12 242 3.0E-13
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 2 216 4.0E-13
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 4 228 4.0E-13
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 4 228 4.0E-13
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 4 228 4.0E-13
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 4 228 4.0E-13
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 18 239 7.0E-13
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 11 216 8.0E-13
sp|A8WU31|VRK1_CAEBR Serine/threonine-protein kinase VRK1 OS=Caenorhabditis briggsae GN=vrk-1 PE=3 SV=1 5 235 8.0E-13
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 1 344 8.0E-13
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 12 242 1.0E-12
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 18 239 2.0E-12
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 12 239 2.0E-12
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 12 239 2.0E-12
sp|Q19848|VRK1_CAEEL Serine/threonine-protein kinase VRK1 OS=Caenorhabditis elegans GN=vrk-1 PE=1 SV=1 5 225 2.0E-12
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 12 239 2.0E-12
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 5 288 2.0E-12
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 12 239 3.0E-12
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 5 288 3.0E-12
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 12 242 4.0E-12
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 5 227 5.0E-12
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 7 218 6.0E-12
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 12 239 6.0E-12
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 6 218 8.0E-12
sp|P54743|PKNA_MYCLE Serine/threonine-protein kinase PknA OS=Mycobacterium leprae (strain TN) GN=pknA PE=3 SV=3 4 228 8.0E-12
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 10 239 9.0E-12
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 5 239 1.0E-11
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 11 267 1.0E-11
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 11 219 1.0E-11
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 10 216 1.0E-11
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 10 235 2.0E-11
sp|Q09437|YP62_CAEEL Putative serine/threonine-protein kinase B0495.2 OS=Caenorhabditis elegans GN=B0495.2 PE=3 SV=1 4 276 2.0E-11
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 10 218 2.0E-11
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 15 220 3.0E-11
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 12 242 3.0E-11
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 18 215 3.0E-11
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 11 169 4.0E-11
sp|Q9YHZ5|PIM2_DANRE Serine/threonine-protein kinase pim-2 OS=Danio rerio GN=pim2 PE=2 SV=2 11 161 5.0E-11
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 11 219 5.0E-11
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 8 218 6.0E-11
sp|Q8FUI5|PKN1_COREF Probable serine/threonine-protein kinase CE0033 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0033 PE=3 SV=1 4 264 7.0E-11
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 6 216 7.0E-11
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 12 160 1.0E-10
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 8 294 1.0E-10
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 10 242 1.0E-10
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 8 294 1.0E-10
sp|Q54LR6|Y6481_DICDI Probable serine/threonine-protein kinase DDB_G0286481 OS=Dictyostelium discoideum GN=DDB_G0286481 PE=3 SV=1 10 165 1.0E-10
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 4 216 2.0E-10
sp|Q63184|E2AK2_RAT Interferon-induced, double-stranded RNA-activated protein kinase OS=Rattus norvegicus GN=Eif2ak2 PE=1 SV=1 3 211 2.0E-10
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 5 242 2.0E-10
sp|O84303|PKND_CHLTR Serine/threonine-protein kinase PknD OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=pknD PE=1 SV=1 10 217 2.0E-10
sp|Q3KM61|PKND_CHLTA Serine/threonine-protein kinase PknD OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=pknD PE=3 SV=1 10 217 2.0E-10
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 12 217 2.0E-10
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 10 161 2.0E-10
sp|Q7T6Y1|YR436_MIMIV Putative serine/threonine-protein kinase R436 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R436 PE=3 SV=2 8 222 2.0E-10
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 18 216 2.0E-10
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 11 216 2.0E-10
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 12 242 3.0E-10
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 10 218 3.0E-10
sp|B0BBT2|PKND_CHLTB Serine/threonine-protein kinase PknD OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=pknD PE=3 SV=1 10 217 3.0E-10
sp|B0B7L7|PKND_CHLT2 Serine/threonine-protein kinase PknD OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=pknD PE=3 SV=1 10 217 3.0E-10
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 10 263 3.0E-10
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 9 157 3.0E-10
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 12 216 3.0E-10
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 12 216 4.0E-10
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 10 217 4.0E-10
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 14 285 4.0E-10
sp|P10533|RMIL_AVII1 Serine/threonine-protein kinase-transforming protein Rmil OS=Avian retrovirus IC10 GN=V-RMIL PE=3 SV=1 14 219 4.0E-10
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 10 215 4.0E-10
sp|P27966|RMIL_AVEVR Serine/threonine-protein kinase-transforming protein Rmil OS=Avian rous-associated virus type 1 GN=V-RMIL PE=3 SV=1 14 219 5.0E-10
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 10 161 5.0E-10
sp|Q9PK92|PKND_CHLMU Serine/threonine-protein kinase PknD OS=Chlamydia muridarum (strain MoPn / Nigg) GN=pknD PE=3 SV=1 10 217 5.0E-10
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 3 156 5.0E-10
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 12 216 6.0E-10
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 12 239 6.0E-10
sp|Q9BZL6|KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens GN=PRKD2 PE=1 SV=2 18 216 6.0E-10
sp|Q5XIS9|KPCD2_RAT Serine/threonine-protein kinase D2 OS=Rattus norvegicus GN=Prkd2 PE=1 SV=1 18 216 6.0E-10
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 12 216 6.0E-10
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 18 215 6.0E-10
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 18 216 6.0E-10
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 7 157 6.0E-10
sp|Q9FAB3|SPKA_SYNY3 Serine/threonine-protein kinase A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=spkA PE=1 SV=1 8 215 6.0E-10
sp|Q8BZ03|KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus GN=Prkd2 PE=1 SV=1 18 216 6.0E-10
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 11 273 6.0E-10
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 12 239 7.0E-10
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 11 273 7.0E-10
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 7 157 7.0E-10
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 2 156 7.0E-10
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 10 242 7.0E-10
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 12 239 7.0E-10
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 8 218 8.0E-10
sp|Q9FGW5|CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana GN=CDKG1 PE=1 SV=1 7 276 8.0E-10
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 10 242 8.0E-10
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 2 156 8.0E-10
sp|Q54VU4|Y8013_DICDI Probable serine/threonine-protein kinase DDB_G0280133 OS=Dictyostelium discoideum GN=DDB_G0280133 PE=3 SV=1 11 216 9.0E-10
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 2 156 9.0E-10
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 2 156 9.0E-10
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 2 156 9.0E-10
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 2 216 9.0E-10
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 8 305 9.0E-10
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 8 161 1.0E-09
sp|Q54W86|MYLKF_DICDI Probable myosin light chain kinase DDB_G0279831 OS=Dictyostelium discoideum GN=DDB_G0279831 PE=3 SV=1 6 156 1.0E-09
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 12 216 1.0E-09
sp|P15056|BRAF_HUMAN Serine/threonine-protein kinase B-raf OS=Homo sapiens GN=BRAF PE=1 SV=4 14 219 1.0E-09
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 10 161 1.0E-09
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 10 161 1.0E-09
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 8 279 1.0E-09
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 2 156 1.0E-09
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 11 218 1.0E-09
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 12 239 1.0E-09
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 12 218 1.0E-09
sp|P34908|BRAF_COTJA Serine/threonine-protein kinase B-raf OS=Coturnix coturnix japonica GN=BRAF PE=2 SV=1 14 219 1.0E-09
sp|Q04982|BRAF_CHICK Serine/threonine-protein kinase B-raf OS=Gallus gallus GN=BRAF PE=1 SV=1 14 219 1.0E-09
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 10 156 1.0E-09
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 11 158 1.0E-09
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 12 216 1.0E-09
sp|P28028|BRAF_MOUSE Serine/threonine-protein kinase B-raf OS=Mus musculus GN=Braf PE=1 SV=3 14 219 1.0E-09
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 7 218 1.0E-09
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 10 239 1.0E-09
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 10 216 2.0E-09
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 12 216 2.0E-09
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 8 288 2.0E-09
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 12 216 2.0E-09
sp|Q90ZY4|SBK1_DANRE Serine/threonine-protein kinase SBK1 OS=Danio rerio GN=sbk1 PE=1 SV=1 6 217 2.0E-09
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 2 156 2.0E-09
sp|Q9Z986|PKND_CHLPN Serine/threonine-protein kinase PknD OS=Chlamydia pneumoniae GN=pknD PE=3 SV=2 10 242 2.0E-09
sp|P54737|PKN5_MYXXA Serine/threonine-protein kinase pkn5 OS=Myxococcus xanthus GN=pkn5 PE=2 SV=1 93 244 2.0E-09
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 9 288 2.0E-09
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 10 216 2.0E-09
sp|P54742|AFSK_STRGR Serine/threonine-protein kinase AfsK OS=Streptomyces griseus GN=afsK PE=3 SV=1 1 218 2.0E-09
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 12 242 2.0E-09
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 12 216 2.0E-09
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 12 216 2.0E-09
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 8 223 2.0E-09
sp|P51568|AFC3_ARATH Serine/threonine-protein kinase AFC3 OS=Arabidopsis thaliana GN=AFC3 PE=2 SV=2 11 217 3.0E-09
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 12 216 3.0E-09
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 11 267 3.0E-09
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 18 215 3.0E-09
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 8 247 3.0E-09
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 8 161 3.0E-09
sp|P51566|AFC1_ARATH Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2 11 232 3.0E-09
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 8 239 4.0E-09
sp|Q8NU98|PKN1_CORGL Probable serine/threonine-protein kinase PknB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknB PE=3 SV=1 4 218 4.0E-09
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 11 242 4.0E-09
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 3 218 4.0E-09
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 8 161 4.0E-09
sp|O74426|PPK33_SCHPO Serine/threonine-protein kinase ppk33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk33 PE=3 SV=1 10 210 4.0E-09
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 9 216 4.0E-09
sp|Q03963|E2AK2_MOUSE Interferon-induced, double-stranded RNA-activated protein kinase OS=Mus musculus GN=Eif2ak2 PE=1 SV=2 3 210 4.0E-09
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 10 215 4.0E-09
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 8 239 5.0E-09
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 8 288 5.0E-09
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 12 218 5.0E-09
sp|Q01919|KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN4 PE=1 SV=1 12 216 6.0E-09
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 12 220 6.0E-09
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 12 233 6.0E-09
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 11 287 6.0E-09
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 5 288 7.0E-09
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 1 221 7.0E-09
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 12 242 7.0E-09
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 11 234 7.0E-09
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 12 242 7.0E-09
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 7 286 7.0E-09
sp|O31435|YBDM_BACSU Probable serine/threonine-protein kinase YbdM OS=Bacillus subtilis (strain 168) GN=ybdM PE=1 SV=1 8 158 8.0E-09
sp|P19454|CSK22_YEAST Casein kinase II subunit alpha' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CKA2 PE=1 SV=2 2 160 8.0E-09
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 11 223 8.0E-09
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 11 223 8.0E-09
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 11 223 8.0E-09
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 12 218 8.0E-09
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 10 239 8.0E-09
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 4 230 9.0E-09
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 12 218 9.0E-09
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 11 223 9.0E-09
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 18 219 9.0E-09
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 1 161 9.0E-09
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 12 218 9.0E-09
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 8 227 1.0E-08
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 10 242 1.0E-08
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 7 161 1.0E-08
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 7 217 1.0E-08
sp|P54741|AFSK_STRCO Serine/threonine-protein kinase AfsK OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=afsK PE=1 SV=2 1 218 1.0E-08
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 7 217 1.0E-08
sp|Q7XUF4|CDKG2_ORYSJ Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. japonica GN=CDKG-2 PE=2 SV=2 17 306 1.0E-08
sp|A2XUW1|CDKG2_ORYSI Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. indica GN=CDKG-2 PE=3 SV=1 17 306 1.0E-08
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 12 218 1.0E-08
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 9 216 1.0E-08
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 10 215 1.0E-08
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 8 216 1.0E-08
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 2 156 1.0E-08
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 2 156 1.0E-08
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 2 156 1.0E-08
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 7 221 1.0E-08
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 16 215 1.0E-08
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 12 233 1.0E-08
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 11 216 1.0E-08
sp|Q54C18|Y9452_DICDI Probable serine/threonine-protein kinase DDB_G0293276 OS=Dictyostelium discoideum GN=DDB_G0293276 PE=3 SV=1 1 234 1.0E-08
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 11 216 1.0E-08
sp|Q86V86|PIM3_HUMAN Serine/threonine-protein kinase pim-3 OS=Homo sapiens GN=PIM3 PE=1 SV=3 12 161 1.0E-08
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 12 218 1.0E-08
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 3 233 2.0E-08
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 8 239 2.0E-08
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 11 216 2.0E-08
sp|P09769|FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens GN=FGR PE=1 SV=2 16 287 2.0E-08
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 11 216 2.0E-08
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 8 216 2.0E-08
sp|O14132|PIT1_SCHPO Sporulation protein kinase pit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pit1 PE=1 SV=1 6 166 2.0E-08
sp|Q822K5|PKND_CHLCV Serine/threonine-protein kinase PknD OS=Chlamydophila caviae (strain GPIC) GN=pknD PE=3 SV=1 10 242 2.0E-08
sp|P42689|SRK3_SPOLA Tyrosine-protein kinase SRK3 (Fragment) OS=Spongilla lacustris GN=SRK3 PE=2 SV=1 13 281 2.0E-08
sp|P08092|RAN1_SCHPO Negative regulator of sexual conjugation and meiosis OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ran1 PE=1 SV=2 8 217 2.0E-08
sp|P54735|SPKD_SYNY3 Serine/threonine-protein kinase D OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=spkD PE=1 SV=1 4 158 2.0E-08
sp|Q11090|YWY3_CAEEL Putative serine/threonine-protein kinase C01C4.3 OS=Caenorhabditis elegans GN=C01C4.3 PE=3 SV=3 12 217 2.0E-08
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 2 156 2.0E-08
sp|A0QNG1|PKNB_MYCS2 Serine/threonine-protein kinase PknB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=pknB PE=1 SV=1 1 218 2.0E-08
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 1 161 2.0E-08
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 12 216 2.0E-08
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 2 156 2.0E-08
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 15 220 2.0E-08
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 12 158 2.0E-08
sp|Q5L5J7|PKND_CHLAB Serine/threonine-protein kinase PknD OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=pknD PE=3 SV=1 10 279 2.0E-08
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 11 233 2.0E-08
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 11 232 2.0E-08
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 11 232 2.0E-08
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 12 241 2.0E-08
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 12 242 2.0E-08
sp|C0LGI2|Y1677_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g67720 OS=Arabidopsis thaliana GN=At1g67720 PE=2 SV=1 15 215 2.0E-08
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 11 239 2.0E-08
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 2 156 2.0E-08
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 10 161 3.0E-08
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 2 156 3.0E-08
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 10 160 3.0E-08
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 4 288 3.0E-08
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 7 217 3.0E-08
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 2 156 3.0E-08
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 2 156 3.0E-08
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 12 233 3.0E-08
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 8 330 3.0E-08
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 2 156 3.0E-08
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 2 156 3.0E-08
sp|P24719|MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEK1 PE=3 SV=1 6 218 3.0E-08
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 12 233 3.0E-08
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 11 156 3.0E-08
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 4 288 3.0E-08
sp|Q09639|GRK2_CAEEL G protein-coupled receptor kinase 2 OS=Caenorhabditis elegans GN=grk-2 PE=3 SV=2 10 247 3.0E-08
sp|Q62070|PIM2_MOUSE Serine/threonine-protein kinase pim-2 OS=Mus musculus GN=Pim2 PE=1 SV=1 11 166 3.0E-08
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 2 156 3.0E-08
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 8 330 3.0E-08
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 8 330 3.0E-08
sp|Q61RA2|CHK1_CAEBR Serine/threonine-protein kinase chk-1 OS=Caenorhabditis briggsae GN=chk-1 PE=3 SV=1 12 216 3.0E-08
sp|P40231|CSK2A_SCHPO Casein kinase II subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cka1 PE=2 SV=2 10 159 3.0E-08
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 4 288 3.0E-08
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 11 232 3.0E-08
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 4 288 3.0E-08
sp|Q7U095|PKNH_MYCBO Serine/threonine-protein kinase PknH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknH PE=3 SV=1 5 223 3.0E-08
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 5 217 4.0E-08
sp|P58750|PIM3_MOUSE Serine/threonine-protein kinase pim-3 OS=Mus musculus GN=Pim3 PE=1 SV=1 12 161 4.0E-08
sp|P9WI71|PKNH_MYCTU Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknH PE=1 SV=1 5 223 4.0E-08
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 10 230 4.0E-08
sp|P9WI70|PKNH_MYCTO Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknH PE=3 SV=1 5 223 4.0E-08
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 5 217 4.0E-08
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 5 217 4.0E-08
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 12 245 4.0E-08
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 10 160 4.0E-08
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 7 242 4.0E-08
sp|O70444|PIM3_RAT Serine/threonine-protein kinase pim-3 OS=Rattus norvegicus GN=Pim3 PE=1 SV=3 12 161 4.0E-08
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 10 217 4.0E-08
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 8 236 4.0E-08
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 2 156 4.0E-08
sp|Q28923|YES_CANLF Tyrosine-protein kinase Yes OS=Canis lupus familiaris GN=YES1 PE=1 SV=3 13 287 4.0E-08
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 12 215 5.0E-08
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 7 243 5.0E-08
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 10 242 5.0E-08
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 10 239 5.0E-08
sp|Q6C842|BUR1_YARLI Serine/threonine-protein kinase BUR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BUR1 PE=3 SV=1 8 178 5.0E-08
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 12 216 5.0E-08
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 13 217 5.0E-08
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 12 156 5.0E-08
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 12 156 5.0E-08
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 7 220 5.0E-08
sp|Q9WTQ1|KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus GN=Prkd1 PE=1 SV=2 18 216 6.0E-08
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 12 239 6.0E-08
sp|Q9W0V1|PDPK1_DROME 3-phosphoinositide-dependent protein kinase 1 OS=Drosophila melanogaster GN=Pdk1 PE=1 SV=4 7 157 6.0E-08
sp|Q52WX2|SBK1_HUMAN Serine/threonine-protein kinase SBK1 OS=Homo sapiens GN=SBK1 PE=2 SV=1 8 222 6.0E-08
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 12 184 6.0E-08
sp|Q15139|KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens GN=PRKD1 PE=1 SV=2 18 216 6.0E-08
sp|Q62101|KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus GN=Prkd1 PE=1 SV=2 18 216 6.0E-08
sp|O94806|KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens GN=PRKD3 PE=1 SV=1 18 216 6.0E-08
sp|P00521|ABL_MLVAB Tyrosine-protein kinase transforming protein Abl OS=Abelson murine leukemia virus GN=ABL PE=3 SV=1 17 372 6.0E-08
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 1 233 7.0E-08
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 16 240 7.0E-08
sp|Q9Z335|SBK1_RAT Serine/threonine-protein kinase SBK1 OS=Rattus norvegicus GN=Sbk1 PE=1 SV=1 8 222 7.0E-08
sp|Q8K1Y2|KPCD3_MOUSE Serine/threonine-protein kinase D3 OS=Mus musculus GN=Prkd3 PE=1 SV=1 18 216 7.0E-08
sp|Q8QZX0|SBK1_MOUSE Serine/threonine-protein kinase SBK1 OS=Mus musculus GN=Sbk1 PE=2 SV=1 8 222 7.0E-08
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 4 216 7.0E-08
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 6 239 7.0E-08
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 6 220 8.0E-08
sp|Q925K9|TSSK6_MOUSE Testis-specific serine/threonine-protein kinase 6 OS=Mus musculus GN=Tssk6 PE=2 SV=1 12 216 8.0E-08
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 16 240 8.0E-08
sp|Q9Z0H0|CDC7_MOUSE Cell division cycle 7-related protein kinase OS=Mus musculus GN=Cdc7 PE=1 SV=2 10 166 8.0E-08
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 5 232 8.0E-08
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 10 239 8.0E-08
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 7 156 8.0E-08
sp|P26794|PIM1_RAT Serine/threonine-protein kinase pim-1 OS=Rattus norvegicus GN=Pim1 PE=1 SV=1 10 273 8.0E-08
sp|Q07174|M3K8_MOUSE Mitogen-activated protein kinase kinase kinase 8 OS=Mus musculus GN=Map3k8 PE=1 SV=1 16 216 9.0E-08
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 10 239 9.0E-08
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 12 216 9.0E-08
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 11 184 9.0E-08
sp|P07947|YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens GN=YES1 PE=1 SV=3 13 287 9.0E-08
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 7 218 9.0E-08
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 12 216 9.0E-08
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 11 184 1.0E-07
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 18 156 1.0E-07
sp|O00311|CDC7_HUMAN Cell division cycle 7-related protein kinase OS=Homo sapiens GN=CDC7 PE=1 SV=1 7 166 1.0E-07
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 7 240 1.0E-07
sp|Q9BXA6|TSSK6_HUMAN Testis-specific serine/threonine-protein kinase 6 OS=Homo sapiens GN=TSSK6 PE=1 SV=1 12 216 1.0E-07
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 12 161 1.0E-07
sp|Q95YH0|CDK8_DICDI Probable cyclin-dependent kinase 8 OS=Dictyostelium discoideum GN=cdk8 PE=2 SV=1 2 206 1.0E-07
sp|Q3UIZ8|MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus GN=Mylk3 PE=1 SV=1 18 218 1.0E-07
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 12 239 1.0E-07
sp|Q9XBQ0|PKN3_MYXXA Serine/threonine-protein kinase pkn3 OS=Myxococcus xanthus GN=pkn3 PE=3 SV=1 8 217 1.0E-07
sp|Q10156|LKH1_SCHPO Dual specificity protein kinase lkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lkh1 PE=1 SV=3 7 236 1.0E-07
sp|P83101|GSK3H_DROME Putative glycogen synthase kinase-3 homolog OS=Drosophila melanogaster GN=gskt PE=2 SV=1 12 240 1.0E-07
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 10 289 1.0E-07
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 7 239 1.0E-07
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 10 239 1.0E-07
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 12 245 1.0E-07
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 7 182 1.0E-07
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 7 220 1.0E-07
sp|Q8SSA8|CHK1_ENCCU Probable serine/threonine-protein kinase CHK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHK1 PE=3 SV=1 114 216 1.0E-07
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 10 216 1.0E-07
sp|P53682|CDPK1_ORYSJ Calcium-dependent protein kinase isoform 1 OS=Oryza sativa subsp. japonica GN=SPK PE=2 SV=2 12 160 1.0E-07
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 12 233 1.0E-07
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 8 218 1.0E-07
sp|Q04736|YES_MOUSE Tyrosine-protein kinase Yes OS=Mus musculus GN=Yes1 PE=1 SV=3 13 287 1.0E-07
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 10 239 1.0E-07
sp|A8C984|MYLK3_DANRE Myosin light chain kinase 3 OS=Danio rerio GN=mylk3 PE=2 SV=1 18 218 1.0E-07
sp|Q04899|CDK18_MOUSE Cyclin-dependent kinase 18 OS=Mus musculus GN=Cdk18 PE=1 SV=1 17 261 1.0E-07
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 12 239 1.0E-07
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 16 240 1.0E-07
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 12 240 1.0E-07
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 12 157 1.0E-07
sp|P41279|M3K8_HUMAN Mitogen-activated protein kinase kinase kinase 8 OS=Homo sapiens GN=MAP3K8 PE=1 SV=2 16 216 1.0E-07
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 12 216 1.0E-07
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 16 240 1.0E-07
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 7 218 1.0E-07
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 12 216 1.0E-07
sp|P51567|AFC2_ARATH Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1 11 217 2.0E-07
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 7 161 2.0E-07
sp|F1LM93|YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus GN=Yes1 PE=1 SV=1 13 287 2.0E-07
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 5 216 2.0E-07
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 16 240 2.0E-07
sp|O97627|ARBK1_DIDVI Beta-adrenergic receptor kinase 1 OS=Didelphis virginiana GN=ADRBK1 PE=1 SV=1 10 226 2.0E-07
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 10 215 2.0E-07
sp|Q8C0N0|SMKZ_MOUSE Sperm motility kinase Z OS=Mus musculus GN=Gm4922 PE=2 SV=1 11 218 2.0E-07
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 10 184 2.0E-07
sp|G5EBT1|SMA5_CAEEL Mitogen-activated protein kinase sma-5 OS=Caenorhabditis elegans GN=sma-5 PE=2 SV=1 7 157 2.0E-07
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 10 239 2.0E-07
sp|Q6P6U0|FGR_RAT Tyrosine-protein kinase Fgr OS=Rattus norvegicus GN=Fgr PE=1 SV=1 10 287 2.0E-07
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 10 206 2.0E-07
sp|Q07002|CDK18_HUMAN Cyclin-dependent kinase 18 OS=Homo sapiens GN=CDK18 PE=1 SV=3 17 241 2.0E-07
sp|Q5RD01|CDK18_PONAB Cyclin-dependent kinase 18 OS=Pongo abelii GN=CDK18 PE=2 SV=2 17 254 2.0E-07
sp|Q63562|M3K8_RAT Mitogen-activated protein kinase kinase kinase 8 OS=Rattus norvegicus GN=Map3k8 PE=1 SV=1 16 216 2.0E-07
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 12 156 2.0E-07
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 16 240 2.0E-07
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 16 242 2.0E-07
sp|O35832|CKD18_RAT Cyclin-dependent kinase 18 OS=Rattus norvegicus GN=Cdk18 PE=1 SV=1 17 261 2.0E-07
sp|Q00536|CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens GN=CDK16 PE=1 SV=1 17 259 2.0E-07
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 7 218 2.0E-07
sp|Q255D2|PKND_CHLFF Serine/threonine-protein kinase PknD OS=Chlamydophila felis (strain Fe/C-56) GN=pknD PE=3 SV=2 10 242 2.0E-07
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 114 233 2.0E-07
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 10 239 2.0E-07
sp|E9PT87|MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus GN=Mylk3 PE=1 SV=1 1 218 2.0E-07
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 8 216 2.0E-07
sp|P26818|ARBK2_BOVIN Beta-adrenergic receptor kinase 2 OS=Bos taurus GN=ADRBK2 PE=2 SV=1 10 226 2.0E-07
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 10 217 2.0E-07
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 12 236 2.0E-07
sp|Q5SUV5|MYLK4_MOUSE Myosin light chain kinase family member 4 OS=Mus musculus GN=Mylk4 PE=1 SV=2 8 218 2.0E-07
sp|Q8FUI4|PKN2_COREF Serine/threonine-protein kinases drp72 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=CE0034 PE=3 SV=1 8 265 2.0E-07
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 16 219 2.0E-07
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 8 162 2.0E-07
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 10 216 2.0E-07
sp|Q9P1W9|PIM2_HUMAN Serine/threonine-protein kinase pim-2 OS=Homo sapiens GN=PIM2 PE=1 SV=1 11 166 2.0E-07
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 11 157 2.0E-07
sp|P10936|YES_XENLA Tyrosine-protein kinase Yes OS=Xenopus laevis GN=yes1 PE=2 SV=3 13 287 2.0E-07
sp|Q04735|CDK16_MOUSE Cyclin-dependent kinase 16 OS=Mus musculus GN=Cdk16 PE=1 SV=1 17 259 2.0E-07
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 10 205 2.0E-07
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 5 219 3.0E-07
sp|Q6NU98|PDK1B_XENLA Serine/threonine-protein kinase pdik1l-B OS=Xenopus laevis GN=pdik1-b PE=2 SV=1 11 180 3.0E-07
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 18 157 3.0E-07
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 16 240 3.0E-07
sp|P09324|YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus GN=YES1 PE=1 SV=3 13 287 3.0E-07
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 12 161 3.0E-07
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 16 240 3.0E-07
sp|P25098|ARBK1_HUMAN Beta-adrenergic receptor kinase 1 OS=Homo sapiens GN=ADRBK1 PE=1 SV=2 10 226 3.0E-07
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 10 242 3.0E-07
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 18 157 3.0E-07
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 9 161 3.0E-07
sp|P26817|ARBK1_RAT Beta-adrenergic receptor kinase 1 OS=Rattus norvegicus GN=Adrbk1 PE=1 SV=1 10 226 3.0E-07
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 111 242 3.0E-07
sp|Q54TW2|PDPKA_DICDI Probable serine/threonine-protein kinase pdkA OS=Dictyostelium discoideum GN=pdkA PE=3 SV=1 12 162 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|411
MTTMDLRVGNKYRIGRKIGSGSFGDIYLGTNIISGEEIAIKLESVKAKHPQLEYEARVYKSLAGGVGIPFVRWFG
TECDYNAMVLDLLGPSLEDLFNFCNRKFSLKTVLLLADQLISRIEYIHAKSFIHRDIKPDNFLMGIGKRGNQVNV
IDFGLAKKYRDPKTHFHIPYRENKNLTGTARYASINTHLGVEQSRRDDMESLGYVMLYFCRGSLPWQGLKAATKK
QKYDRIMEKKMTTPTEVLCRGFPNEFAIYLNYTRSLRFDDKPDYSYLRKIFRDLFVREGFQYDYVFDWTVYKYQK
NAQAIAQAAGQTNPEDEEKARASRANAAAAGQAGAAKPNAIPSSRRKMLERGSGAGVDTPDTNRAIGGSDRM*
Coding >Hirsu2|411
ATGACGACCATGGATCTCCGCGTCGGTAACAAGTACCGCATCGGCCGAAAGATCGGCTCCGGCTCCTTTGGCGAC
ATCTACCTCGGCACCAACATCATCTCGGGCGAGGAAATCGCCATCAAGCTCGAGTCCGTCAAGGCCAAGCACCCC
CAGCTCGAGTATGAGGCCCGCGTCTACAAGTCCCTCGCCGGCGGCGTCGGCATCCCCTTCGTCCGCTGGTTCGGC
ACCGAGTGCGACTACAACGCCATGGTCCTCGACCTCCTCGGGCCCAGCCTCGAGGACCTCTTCAACTTCTGCAAC
CGCAAGTTCTCCCTCAAGACGGTCCTCCTCCTCGCCGACCAGCTCATCTCCCGCATCGAGTACATCCACGCCAAG
TCCTTCATCCACCGCGACATCAAGCCCGACAACTTCCTCATGGGCATCGGCAAGCGTGGCAACCAGGTCAACGTC
ATCGACTTCGGCCTGGCCAAGAAGTATCGCGACCCCAAGACGCACTTCCACATCCCCTACCGCGAGAACAAGAAC
TTGACCGGCACCGCCCGCTATGCCTCCATCAACACCCACCTCGGCGTCGAGCAGTCCCGCCGCGACGACATGGAA
TCTCTCGGCTACGTCATGCTCTACTTCTGCCGCGGCTCCCTCCCCTGGCAGGGCCTCAAGGCGGCCACCAAGAAG
CAAAAGTACGACCGCATCATGGAGAAGAAGATGACGACGCCCACCGAGGTGCTCTGCCGCGGCTTCCCCAACGAG
TTCGCCATTTACCTCAACTACACCCGCTCGCTCCGCTTCGACGACAAGCCCGACTACAGCTACCTCCGCAAGATC
TTCCGCGACCTCTTCGTCCGCGAGGGCTTCCAGTACGACTACGTCTTCGACTGGACCGTCTACAAGTACCAGAAG
AATGCCCAGGCCATCGCCCAGGCCGCCGGTCAGACCAACCCCGAGGACGAGGAGAAGGCCCGCGCCTCGCGCGCC
AACGCCGCCGCCGCCGGCCAGGCCGGCGCCGCCAAGCCCAATGCCATTCCCAGCTCTCGCCGCAAGATGCTCGAG
CGCGGCTCCGGTGCCGGCGTCGACACCCCGGATACCAATCGTGCCATCGGCGGTAGCGACAGGATGTGA
Transcript >Hirsu2|411
ATGACGACCATGGATCTCCGCGTCGGTAACAAGTACCGCATCGGCCGAAAGATCGGCTCCGGCTCCTTTGGCGAC
ATCTACCTCGGCACCAACATCATCTCGGGCGAGGAAATCGCCATCAAGCTCGAGTCCGTCAAGGCCAAGCACCCC
CAGCTCGAGTATGAGGCCCGCGTCTACAAGTCCCTCGCCGGCGGCGTCGGCATCCCCTTCGTCCGCTGGTTCGGC
ACCGAGTGCGACTACAACGCCATGGTCCTCGACCTCCTCGGGCCCAGCCTCGAGGACCTCTTCAACTTCTGCAAC
CGCAAGTTCTCCCTCAAGACGGTCCTCCTCCTCGCCGACCAGCTCATCTCCCGCATCGAGTACATCCACGCCAAG
TCCTTCATCCACCGCGACATCAAGCCCGACAACTTCCTCATGGGCATCGGCAAGCGTGGCAACCAGGTCAACGTC
ATCGACTTCGGCCTGGCCAAGAAGTATCGCGACCCCAAGACGCACTTCCACATCCCCTACCGCGAGAACAAGAAC
TTGACCGGCACCGCCCGCTATGCCTCCATCAACACCCACCTCGGCGTCGAGCAGTCCCGCCGCGACGACATGGAA
TCTCTCGGCTACGTCATGCTCTACTTCTGCCGCGGCTCCCTCCCCTGGCAGGGCCTCAAGGCGGCCACCAAGAAG
CAAAAGTACGACCGCATCATGGAGAAGAAGATGACGACGCCCACCGAGGTGCTCTGCCGCGGCTTCCCCAACGAG
TTCGCCATTTACCTCAACTACACCCGCTCGCTCCGCTTCGACGACAAGCCCGACTACAGCTACCTCCGCAAGATC
TTCCGCGACCTCTTCGTCCGCGAGGGCTTCCAGTACGACTACGTCTTCGACTGGACCGTCTACAAGTACCAGAAG
AATGCCCAGGCCATCGCCCAGGCCGCCGGTCAGACCAACCCCGAGGACGAGGAGAAGGCCCGCGCCTCGCGCGCC
AACGCCGCCGCCGCCGGCCAGGCCGGCGCCGCCAAGCCCAATGCCATTCCCAGCTCTCGCCGCAAGATGCTCGAG
CGCGGCTCCGGTGCCGGCGTCGACACCCCGGATACCAATCGTGCCATCGGCGGTAGCGACAGGATGTGA
Gene >Hirsu2|411
ATGACGACCATGGTGAGTTCCCCTCCGTGATCACTTCACCTCTTTTTTTCCCTGCAGAAGGCGTCCGTCCGCGGT
TTTGCACCCGCGCGCCCTGCGTCTCGAGAGGGCGCTCTGAGCGGCGTGAGCAGCAGCGGCTTGTGCATCATCCTT
GACGCTTGACCGTCTCGCCTTCGGGTGTGGGTCTGCTGCCCGCCCCTCTCGGCTCATCACGCCTTCGCCGCTCCG
CTTCACCGCCCGCTCCTTGCACCTCGCGAGCCCTCTGGTGGCTGACAGACGGTCCAGGATCTCCGCGTCGGTAAC
AAGTACCGCATCGGCCGAAAGATCGGCTCCGGCTCCTTTGGCGACATCTACCTCGGCACCAACATCATCTCGGGC
GAGGAAATCGCCATCAAGCTCGAGTCCGTCAAGGCCAAGCACCCCCAGCTCGAGTATGAGGCCCGCGTCTACAAG
TCCCTCGCCGGCGGCGTCGGCATCCCCTTCGTCCGCTGGTTCGGCACCGAGTGCGACTACAACGCCATGGTCCTC
GACCTCCTCGGGCCCAGCCTCGAGGACCTCTTCAACTTCTGCAACCGCAAGTTCTCCCTCAAGACGGTCCTCCTC
CTCGCCGACCAGCTCATCTCCCGCATCGAGTACATCCACGCCAAGTCCTTCATCCACCGCGACATCAAGCCCGAC
AACTTCCTCATGGGCATCGGCAAGCGTGGCAACCAGGTCAACGTCATCGACTTCGGCCTGGCCAAGAAGTATCGC
GACCCCAAGACGCACTTCCACATCCCCTACCGCGAGAACAAGAACTTGACCGGCACCGCCCGCTATGCCTCCATC
AACACCCACCTCGGCGTCGAGCAGTCCCGCCGCGACGACATGGAATCTCTCGGCTACGTCATGCTCTACTTCTGC
CGCGGCTCCCTCCCCTGGCAGGGCCTCAAGGCGGCCACCAAGAAGCAAAAGTACGACCGCATCATGGAGAAGAAG
ATGACGACGCCCACCGAGGTGCTCTGCCGCGGCTTCCCCAACGAGTTCGCCATTTACCTCAACTACACCCGCTCG
CTCCGCTTCGACGACAAGCCCGACTACAGCTACCTCCGCAAGATCTTCCGCGACCTCTTCGTCCGCGAGGGCTTC
CAGTACGACTACGTCTTCGACTGGACCGTCTACAAGTACCAGAAGAATGCCCAGGCCATCGCCCAGGCCGCCGGT
CAGACCAACCCCGAGGACGAGGAGAAGGCCCGCGCCTCGCGCGCCAACGCCGCCGCCGCCGGCCAGGCCGGCGCC
GCCAAGCCCAATGCCATTCCCAGCTCTCGCCGCAAGATGCTCGAGCGCGGCTCCGGTGCCGGCGTCGACACCCCG
GATACCAATCGTGCCATCGGCGGTAGCGACAGGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail