Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|4095
Gene name
LocationContig_212:2511..3264
Strand-
Gene length (bp)753
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12906 RINGv RING-variant domain 1.3E-08 20 60

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0P496|MARH4_DANRE E3 ubiquitin-protein ligase MARCH4 OS=Danio rerio GN=march4 PE=2 SV=1 17 100 2.0E-07
sp|Q86YJ5|MARH9_HUMAN E3 ubiquitin-protein ligase MARCH9 OS=Homo sapiens GN=MARCH9 PE=1 SV=2 17 95 3.0E-07
sp|Q3TZ87|MARH9_MOUSE E3 ubiquitin-protein ligase MARCH9 OS=Mus musculus GN=March9 PE=2 SV=1 17 95 3.0E-07
sp|Q80TE3|MARH4_MOUSE E3 ubiquitin-protein ligase MARCH4 OS=Mus musculus GN=March4 PE=2 SV=3 17 100 6.0E-07
sp|A6P320|MARHB_RAT E3 ubiquitin-protein ligase MARCH11 OS=Rattus norvegicus GN=March11 PE=1 SV=1 18 99 6.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0P496|MARH4_DANRE E3 ubiquitin-protein ligase MARCH4 OS=Danio rerio GN=march4 PE=2 SV=1 17 100 2.0E-07
sp|Q86YJ5|MARH9_HUMAN E3 ubiquitin-protein ligase MARCH9 OS=Homo sapiens GN=MARCH9 PE=1 SV=2 17 95 3.0E-07
sp|Q3TZ87|MARH9_MOUSE E3 ubiquitin-protein ligase MARCH9 OS=Mus musculus GN=March9 PE=2 SV=1 17 95 3.0E-07
sp|Q80TE3|MARH4_MOUSE E3 ubiquitin-protein ligase MARCH4 OS=Mus musculus GN=March4 PE=2 SV=3 17 100 6.0E-07
sp|A6P320|MARHB_RAT E3 ubiquitin-protein ligase MARCH11 OS=Rattus norvegicus GN=March11 PE=1 SV=1 18 99 6.0E-07
sp|Q8CBH7|MARHB_MOUSE E3 ubiquitin-protein ligase MARCH11 OS=Mus musculus GN=March11 PE=2 SV=2 18 99 7.0E-07
sp|Q9P2E8|MARH4_HUMAN E3 ubiquitin-protein ligase MARCH4 OS=Homo sapiens GN=MARCH4 PE=2 SV=2 17 100 7.0E-07
sp|A6NNE9|MARHB_HUMAN E3 ubiquitin-protein ligase MARCH11 OS=Homo sapiens GN=MARCH11 PE=2 SV=3 18 99 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 82 104 22
2 148 170 22
3 191 209 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|4095
LGISSASSRPSYVSDDPELGRLLSPCKCKGSQKYVHEGCLNSWRLANPMAERNYWQCPTCKFNYRLARLHWASML
SSKWAQVTVTLAVLIVGIFILGFIADPILDLWFDPVGTISDTVTSVVSDVEAIRPPPFEESVSWTEHFAKGFFSL
GFVGFIKSVVAMGPWQWLNLRTSGLLGSGRRRGTGRARMDNFNLVFVLIGAFTFLMAIWKAVRAISTRVLNNVSD
KVLDVSEDDGDEAEDDADEENKKDQ*
Coding >Hirsu2|4095
CTGGGCATCTCGTCGGCTTCGTCGCGCCCGTCCTATGTTTCGGACGACCCCGAACTTGGCCGGCTGTTGTCGCCC
TGCAAATGCAAGGGCTCGCAGAAGTATGTCCACGAAGGCTGCCTCAACTCGTGGCGGCTGGCGAACCCCATGGCC
GAGAGGAACTACTGGCAGTGTCCGACGTGCAAGTTCAACTACAGGCTGGCGCGGCTGCACTGGGCCTCGATGCTG
AGCAGCAAGTGGGCTCAGGTGACGGTAACTCTGGCCGTTTTGATAGTGGGCATCTTCATTCTCGGCTTCATCGCG
GATCCCATCCTGGATCTGTGGTTTGATCCCGTGGGCACCATTAGCGACACCGTCACAAGCGTGGTTTCGGACGTC
GAGGCCATCAGGCCCCCGCCCTTCGAAGAGTCGGTCTCGTGGACAGAGCACTTTGCCAAGGGCTTCTTCTCACTC
GGCTTTGTGGGCTTTATCAAATCCGTGGTTGCAATGGGGCCCTGGCAGTGGCTGAACCTTCGGACCAGCGGCCTG
CTGGGGTCCGGTCGCCGGCGGGGGACCGGGAGGGCAAGAATGGACAACTTCAACCTCGTCTTCGTCCTGATCGGT
GCCTTTACCTTCCTCATGGCGATATGGAAGGCCGTCAGGGCCATCAGCACGCGAGTGCTCAACAACGTGAGCGAC
AAGGTGCTCGACGTGAGCGAGGATGATGGTGACGAGGCCGAAGACGACGCAGATGAAGAGAATAAAAAGGATCAA
TGA
Transcript >Hirsu2|4095
CTGGGCATCTCGTCGGCTTCGTCGCGCCCGTCCTATGTTTCGGACGACCCCGAACTTGGCCGGCTGTTGTCGCCC
TGCAAATGCAAGGGCTCGCAGAAGTATGTCCACGAAGGCTGCCTCAACTCGTGGCGGCTGGCGAACCCCATGGCC
GAGAGGAACTACTGGCAGTGTCCGACGTGCAAGTTCAACTACAGGCTGGCGCGGCTGCACTGGGCCTCGATGCTG
AGCAGCAAGTGGGCTCAGGTGACGGTAACTCTGGCCGTTTTGATAGTGGGCATCTTCATTCTCGGCTTCATCGCG
GATCCCATCCTGGATCTGTGGTTTGATCCCGTGGGCACCATTAGCGACACCGTCACAAGCGTGGTTTCGGACGTC
GAGGCCATCAGGCCCCCGCCCTTCGAAGAGTCGGTCTCGTGGACAGAGCACTTTGCCAAGGGCTTCTTCTCACTC
GGCTTTGTGGGCTTTATCAAATCCGTGGTTGCAATGGGGCCCTGGCAGTGGCTGAACCTTCGGACCAGCGGCCTG
CTGGGGTCCGGTCGCCGGCGGGGGACCGGGAGGGCAAGAATGGACAACTTCAACCTCGTCTTCGTCCTGATCGGT
GCCTTTACCTTCCTCATGGCGATATGGAAGGCCGTCAGGGCCATCAGCACGCGAGTGCTCAACAACGTGAGCGAC
AAGGTGCTCGACGTGAGCGAGGATGATGGTGACGAGGCCGAAGACGACGCAGATGAAGAGAATAAAAAGGATCAA
TGA
Gene >Hirsu2|4095
CTGGGCATCTCGTCGGCTTCGTCGCGCCCGTCCTATGTTTCGGACGACCCCGAACTTGGCCGGCTGTTGTCGCCC
TGCAAATGCAAGGGCTCGCAGAAGTATGTCCACGAAGGCTGCCTCAACTCGTGGCGGCTGGCGAACCCCATGGCC
GAGAGGAACTACTGGCAGTGTCCGACGTGCAAGTTCAACTACAGGCTGGCGCGGCTGCACTGGGCCTCGATGCTG
AGCAGCAAGTGGGCTCAGGTGACGGTAACTCTGGCCGTTTTGATAGTGGGCATCTTCATTCTCGGCTTCATCGCG
GATCCCATCCTGGATCTGTGGTTTGATCCCGTGGGCACCATTAGCGACACCGTCACAAGCGTGGTTTCGGACGTC
GAGGCCATCAGGCCCCCGCCCTTCGAAGAGTCGGTCTCGTGGACAGAGCACTTTGCCAAGGGCTTCTTCTCACTC
GGCTTTGTGGGCTTTATCAAATCCGTGGTTGCAATGGGGCCCTGGCAGTGGCTGAACCTTCGGACCAGCGGCCTG
CTGGGGTCCGGTCGCCGGCGGGGGACCGGGAGGGCAAGAATGGACAACTTCAACCTCGTCTTCGTCCTGATCGGT
GCCTTTACCTTCCTCATGGCGATATGGAAGGCCGTCAGGGCCATCAGCACGCGAGTGCTCAACAACGTGAGCGAC
AAGGTGCTCGACGTGAGCGAGGATGATGGTGACGAGGCCGAAGACGACGCAGATGAAGAGAATAAAAAGGATCAA
TGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail